Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | NWO26_RS08695 | Genome accession | NZ_CP102797 |
| Coordinates | 1673181..1673390 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST057-1 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1668181..1678390
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWO26_RS08665 | - | 1668590..1669129 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| NWO26_RS08670 | - | 1669440..1669997 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| NWO26_RS08675 | - | 1670000..1670650 (+) | 651 | WP_113870436.1 | phosphatase PAP2 family protein | - |
| NWO26_RS08680 | comR | 1670845..1671744 (+) | 900 | WP_113870435.1 | helix-turn-helix domain-containing protein | Regulator |
| NWO26_RS08685 | - | 1671982..1672413 (+) | 432 | Protein_1657 | cysteine peptidase family C39 domain-containing protein | - |
| NWO26_RS08690 | - | 1672443..1673108 (+) | 666 | Protein_1658 | ABC transporter transmembrane domain-containing protein | - |
| NWO26_RS08695 | comA | 1673181..1673390 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| NWO26_RS08700 | - | 1673445..1674013 (+) | 569 | Protein_1660 | ATP-binding cassette domain-containing protein | - |
| NWO26_RS08705 | - | 1674121..1674438 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| NWO26_RS08710 | - | 1674401..1674685 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| NWO26_RS08715 | - | 1674925..1675227 (-) | 303 | WP_231910735.1 | hypothetical protein | - |
| NWO26_RS08720 | - | 1675451..1675822 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| NWO26_RS08725 | - | 1676227..1676742 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| NWO26_RS08730 | - | 1676767..1677069 (+) | 303 | WP_113870434.1 | urease subunit gamma | - |
| NWO26_RS08735 | - | 1677081..1677392 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=719050 NWO26_RS08695 WP_002946147.1 1673181..1673390(+) (comA) [Streptococcus thermophilus strain ST057-1]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=719050 NWO26_RS08695 WP_002946147.1 1673181..1673390(+) (comA) [Streptococcus thermophilus strain ST057-1]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |