Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | NUU05_RS09055 | Genome accession | NZ_CP102538 |
| Coordinates | 1732040..1732249 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain TH-4 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1727040..1737249
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU05_RS09015 (NUU05_08980) | - | 1728037..1728348 (-) | 312 | WP_002886559.1 | urease subunit beta | - |
| NUU05_RS09020 (NUU05_08985) | - | 1728360..1728662 (-) | 303 | WP_002886558.1 | urease subunit gamma | - |
| NUU05_RS09025 (NUU05_08990) | - | 1728687..1729202 (-) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| NUU05_RS09030 (NUU05_08995) | - | 1729608..1729979 (+) | 372 | WP_224103195.1 | hypothetical protein | - |
| NUU05_RS09035 (NUU05_09000) | - | 1730203..1730505 (+) | 303 | WP_224103194.1 | hypothetical protein | - |
| NUU05_RS09045 (NUU05_09010) | - | 1730998..1731186 (-) | 189 | WP_224103239.1 | hypothetical protein | - |
| NUU05_RS09050 (NUU05_09015) | - | 1731417..1731985 (-) | 569 | Protein_1717 | ATP-binding cassette domain-containing protein | - |
| NUU05_RS09055 (NUU05_09020) | comA | 1732040..1732249 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| NUU05_RS09060 (NUU05_09025) | comA | 1732592..1732882 (-) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| NUU05_RS09065 (NUU05_09030) | - | 1732867..1733511 (-) | 645 | Protein_1720 | cysteine peptidase family C39 domain-containing protein | - |
| NUU05_RS09070 (NUU05_09035) | comR | 1733686..1734585 (-) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| NUU05_RS09075 (NUU05_09040) | - | 1734780..1735430 (-) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| NUU05_RS09080 (NUU05_09045) | - | 1735433..1735990 (-) | 558 | WP_011680718.1 | ECF transporter S component | - |
| NUU05_RS09085 (NUU05_09050) | - | 1736301..1736840 (-) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=717652 NUU05_RS09055 WP_002946147.1 1732040..1732249(-) (comA) [Streptococcus thermophilus strain TH-4]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=717652 NUU05_RS09055 WP_002946147.1 1732040..1732249(-) (comA) [Streptococcus thermophilus strain TH-4]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |