Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NMJ60_RS05840 Genome accession   NZ_CP101314
Coordinates   1172472..1172942 (+) Length   156 a.a.
NCBI ID   WP_000934768.1    Uniprot ID   -
Organism   Staphylococcus aureus strain #492     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1156496..1205718 1172472..1172942 within 0


Gene organization within MGE regions


Location: 1156496..1205718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMJ60_RS05715 - 1156496..1157422 (-) 927 WP_000757575.1 glycerophosphodiester phosphodiesterase -
  NMJ60_RS05720 - 1157661..1157915 (+) 255 WP_001049150.1 YlbG family protein -
  NMJ60_RS05725 - 1157918..1158307 (-) 390 WP_000814565.1 hypothetical protein -
  NMJ60_RS05730 rsmD 1158377..1158919 (+) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  NMJ60_RS05735 coaD 1158921..1159403 (+) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  NMJ60_RS05740 - 1159465..1160604 (-) 1140 WP_000843611.1 nucleotidyltransferase -
  NMJ60_RS05745 - 1160731..1161288 (+) 558 WP_000872158.1 YceD family protein -
  NMJ60_RS05750 rpmF 1161368..1161541 (+) 174 WP_000290472.1 50S ribosomal protein L32 -
  NMJ60_RS05755 - 1161658..1163043 (-) 1386 WP_000861313.1 recombinase family protein -
  NMJ60_RS05760 - 1163250..1163930 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NMJ60_RS05765 - 1163962..1164687 (-) 726 WP_000661437.1 PH domain-containing protein -
  NMJ60_RS05770 - 1164715..1165390 (-) 676 Protein_1129 ImmA/IrrE family metallo-endopeptidase -
  NMJ60_RS05775 - 1165407..1165739 (-) 333 WP_063456459.1 helix-turn-helix domain-containing protein -
  NMJ60_RS05780 - 1166002..1166196 (+) 195 WP_000108122.1 helix-turn-helix domain-containing protein -
  NMJ60_RS05785 - 1166196..1166960 (+) 765 WP_001002760.1 phage antirepressor Ant -
  NMJ60_RS05790 - 1166977..1167171 (+) 195 WP_000390105.1 hypothetical protein -
  NMJ60_RS05795 - 1167375..1167605 (-) 231 WP_000395457.1 hypothetical protein -
  NMJ60_RS05800 - 1167655..1167792 (+) 138 WP_000230552.1 hypothetical protein -
  NMJ60_RS05805 - 1167785..1167952 (+) 168 WP_001285957.1 DUF1270 domain-containing protein -
  NMJ60_RS05810 - 1167953..1168273 (+) 321 WP_000219666.1 hypothetical protein -
  NMJ60_RS05815 - 1168367..1168627 (+) 261 WP_000291075.1 DUF1108 family protein -
  NMJ60_RS05820 - 1168636..1168899 (+) 264 WP_001205732.1 hypothetical protein -
  NMJ60_RS05825 - 1168908..1170851 (+) 1944 WP_000700555.1 AAA family ATPase -
  NMJ60_RS05830 - 1170853..1171773 (+) 921 WP_000138475.1 recombinase RecT -
  NMJ60_RS05835 - 1171854..1172471 (+) 618 WP_071890040.1 MBL fold metallo-hydrolase -
  NMJ60_RS05840 ssbA 1172472..1172942 (+) 471 WP_000934768.1 single-stranded DNA-binding protein Machinery gene
  NMJ60_RS05845 - 1172972..1173859 (+) 888 WP_044422683.1 DnaD domain protein -
  NMJ60_RS05850 - 1173866..1174084 (+) 219 WP_000338528.1 hypothetical protein -
  NMJ60_RS05855 - 1174093..1174497 (+) 405 WP_000401973.1 RusA family crossover junction endodeoxyribonuclease -
  NMJ60_RS05860 - 1174510..1174887 (+) 378 WP_031875644.1 SA1788 family PVL leukocidin-associated protein -
  NMJ60_RS05865 - 1174888..1175136 (+) 249 WP_001126832.1 phi PVL orf 51-like protein -
  NMJ60_RS05870 - 1175149..1175550 (+) 402 WP_323728831.1 hypothetical protein -
  NMJ60_RS05875 - 1175547..1175831 (+) 285 WP_001105618.1 hypothetical protein -
  NMJ60_RS05880 - 1175824..1176072 (+) 249 WP_001065026.1 DUF1024 family protein -
  NMJ60_RS05885 - 1176065..1176601 (+) 537 WP_031789556.1 dUTPase -
  NMJ60_RS05890 - 1176638..1176811 (+) 174 WP_001209219.1 hypothetical protein -
  NMJ60_RS05895 - 1176828..1177034 (+) 207 WP_031786300.1 DUF1381 domain-containing protein -
  NMJ60_RS05900 - 1177031..1177225 (+) 195 WP_000132920.1 hypothetical protein -
  NMJ60_RS05905 - 1177222..1177425 (+) 204 WP_001072795.1 hypothetical protein -
  NMJ60_RS05910 - 1177418..1177654 (+) 237 WP_000608273.1 hypothetical protein -
  NMJ60_RS05915 - 1177644..1178030 (+) 387 WP_010924755.1 hypothetical protein -
  NMJ60_RS05920 rinB 1178030..1178203 (+) 174 WP_000595244.1 transcriptional activator RinB -
  NMJ60_RS05925 - 1178204..1178350 (+) 147 WP_000990001.1 hypothetical protein -
  NMJ60_RS05930 - 1178374..1178796 (+) 423 WP_000162702.1 RinA family phage transcriptional activator -
  NMJ60_RS05935 - 1179124..1179618 (+) 495 WP_000594082.1 terminase small subunit -
  NMJ60_RS05940 - 1179611..1180819 (+) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  NMJ60_RS05945 - 1180833..1182251 (+) 1419 WP_225305868.1 phage portal protein -
  NMJ60_RS05950 - 1182190..1183170 (+) 981 WP_001795666.1 phage head morphogenesis protein -
  NMJ60_RS05955 - 1183268..1183864 (+) 597 WP_000366932.1 phage scaffolding protein -
  NMJ60_RS05960 - 1183885..1184709 (+) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  NMJ60_RS05965 - 1184726..1185052 (+) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  NMJ60_RS05970 - 1185052..1185366 (+) 315 WP_000338935.1 phage head-tail connector protein -
  NMJ60_RS05975 - 1185359..1185694 (+) 336 WP_000482986.1 phage head closure protein -
  NMJ60_RS05980 - 1185681..1186094 (+) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  NMJ60_RS05985 - 1186107..1186544 (+) 438 WP_000270196.1 DUF3168 domain-containing protein -
  NMJ60_RS05990 - 1186531..1187091 (+) 561 WP_000046067.1 hypothetical protein -
  NMJ60_RS05995 - 1187153..1187647 (+) 495 WP_000141082.1 tail assembly chaperone -
  NMJ60_RS06000 - 1187668..1188009 (+) 342 WP_001580347.1 hypothetical protein -
  NMJ60_RS06005 - 1188012..1190981 (+) 2970 WP_044425803.1 phage tail protein -
  NMJ60_RS06010 - 1190996..1191931 (+) 936 WP_000560196.1 phage tail domain-containing protein -
  NMJ60_RS06015 - 1191942..1193828 (+) 1887 WP_044425805.1 SGNH/GDSL hydrolase family protein -
  NMJ60_RS06020 - 1193841..1195739 (+) 1899 WP_063664751.1 hypothetical protein -
  NMJ60_RS06025 - 1195739..1197562 (+) 1824 WP_044425642.1 phage baseplate upper protein -
  NMJ60_RS06030 - 1197562..1197969 (+) 408 WP_044425645.1 DUF2977 domain-containing protein -
  NMJ60_RS06035 - 1197944..1198117 (+) 174 WP_001790193.1 XkdX family protein -
  NMJ60_RS06040 - 1198158..1198457 (+) 300 WP_000466769.1 DUF2951 domain-containing protein -
  NMJ60_RS14310 - 1198594..1198701 (+) 108 Protein_1184 hypothetical protein -
  NMJ60_RS06045 - 1198950..1199570 (+) 621 WP_000355823.1 AP2 domain-containing protein -
  NMJ60_RS06050 - 1199681..1201450 (+) 1770 Protein_1186 glucosaminidase domain-containing protein -
  NMJ60_RS06055 - 1201463..1202635 (+) 1173 WP_044435510.1 BppU family phage baseplate upper protein -
  NMJ60_RS06060 - 1202641..1203036 (+) 396 WP_044435513.1 hypothetical protein -
  NMJ60_RS06065 - 1203092..1203529 (+) 438 WP_000354133.1 phage holin -
  NMJ60_RS06070 - 1203510..1204955 (+) 1446 WP_069479479.1 SH3 domain-containing protein -
  NMJ60_RS06075 - 1205198..1205350 (+) 153 WP_001788502.1 hypothetical protein -
  NMJ60_RS06080 - 1205421..1205531 (+) 111 WP_000139423.1 hypothetical protein -
  NMJ60_RS06085 - 1205533..1205718 (+) 186 WP_001286805.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17747.64 Da        Isoelectric Point: 4.9816

>NTDB_id=709632 NMJ60_RS05840 WP_000934768.1 1172472..1172942(+) (ssbA) [Staphylococcus aureus strain #492]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=709632 NMJ60_RS05840 WP_000934768.1 1172472..1172942(+) (ssbA) [Staphylococcus aureus strain #492]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365