Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NMJ60_RS05840 | Genome accession | NZ_CP101314 |
| Coordinates | 1172472..1172942 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934768.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain #492 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1156496..1205718 | 1172472..1172942 | within | 0 |
Gene organization within MGE regions
Location: 1156496..1205718
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMJ60_RS05715 | - | 1156496..1157422 (-) | 927 | WP_000757575.1 | glycerophosphodiester phosphodiesterase | - |
| NMJ60_RS05720 | - | 1157661..1157915 (+) | 255 | WP_001049150.1 | YlbG family protein | - |
| NMJ60_RS05725 | - | 1157918..1158307 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| NMJ60_RS05730 | rsmD | 1158377..1158919 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| NMJ60_RS05735 | coaD | 1158921..1159403 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| NMJ60_RS05740 | - | 1159465..1160604 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| NMJ60_RS05745 | - | 1160731..1161288 (+) | 558 | WP_000872158.1 | YceD family protein | - |
| NMJ60_RS05750 | rpmF | 1161368..1161541 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| NMJ60_RS05755 | - | 1161658..1163043 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| NMJ60_RS05760 | - | 1163250..1163930 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| NMJ60_RS05765 | - | 1163962..1164687 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| NMJ60_RS05770 | - | 1164715..1165390 (-) | 676 | Protein_1129 | ImmA/IrrE family metallo-endopeptidase | - |
| NMJ60_RS05775 | - | 1165407..1165739 (-) | 333 | WP_063456459.1 | helix-turn-helix domain-containing protein | - |
| NMJ60_RS05780 | - | 1166002..1166196 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| NMJ60_RS05785 | - | 1166196..1166960 (+) | 765 | WP_001002760.1 | phage antirepressor Ant | - |
| NMJ60_RS05790 | - | 1166977..1167171 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| NMJ60_RS05795 | - | 1167375..1167605 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| NMJ60_RS05800 | - | 1167655..1167792 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| NMJ60_RS05805 | - | 1167785..1167952 (+) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| NMJ60_RS05810 | - | 1167953..1168273 (+) | 321 | WP_000219666.1 | hypothetical protein | - |
| NMJ60_RS05815 | - | 1168367..1168627 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| NMJ60_RS05820 | - | 1168636..1168899 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| NMJ60_RS05825 | - | 1168908..1170851 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| NMJ60_RS05830 | - | 1170853..1171773 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| NMJ60_RS05835 | - | 1171854..1172471 (+) | 618 | WP_071890040.1 | MBL fold metallo-hydrolase | - |
| NMJ60_RS05840 | ssbA | 1172472..1172942 (+) | 471 | WP_000934768.1 | single-stranded DNA-binding protein | Machinery gene |
| NMJ60_RS05845 | - | 1172972..1173859 (+) | 888 | WP_044422683.1 | DnaD domain protein | - |
| NMJ60_RS05850 | - | 1173866..1174084 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| NMJ60_RS05855 | - | 1174093..1174497 (+) | 405 | WP_000401973.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NMJ60_RS05860 | - | 1174510..1174887 (+) | 378 | WP_031875644.1 | SA1788 family PVL leukocidin-associated protein | - |
| NMJ60_RS05865 | - | 1174888..1175136 (+) | 249 | WP_001126832.1 | phi PVL orf 51-like protein | - |
| NMJ60_RS05870 | - | 1175149..1175550 (+) | 402 | WP_323728831.1 | hypothetical protein | - |
| NMJ60_RS05875 | - | 1175547..1175831 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| NMJ60_RS05880 | - | 1175824..1176072 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| NMJ60_RS05885 | - | 1176065..1176601 (+) | 537 | WP_031789556.1 | dUTPase | - |
| NMJ60_RS05890 | - | 1176638..1176811 (+) | 174 | WP_001209219.1 | hypothetical protein | - |
| NMJ60_RS05895 | - | 1176828..1177034 (+) | 207 | WP_031786300.1 | DUF1381 domain-containing protein | - |
| NMJ60_RS05900 | - | 1177031..1177225 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| NMJ60_RS05905 | - | 1177222..1177425 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| NMJ60_RS05910 | - | 1177418..1177654 (+) | 237 | WP_000608273.1 | hypothetical protein | - |
| NMJ60_RS05915 | - | 1177644..1178030 (+) | 387 | WP_010924755.1 | hypothetical protein | - |
| NMJ60_RS05920 | rinB | 1178030..1178203 (+) | 174 | WP_000595244.1 | transcriptional activator RinB | - |
| NMJ60_RS05925 | - | 1178204..1178350 (+) | 147 | WP_000990001.1 | hypothetical protein | - |
| NMJ60_RS05930 | - | 1178374..1178796 (+) | 423 | WP_000162702.1 | RinA family phage transcriptional activator | - |
| NMJ60_RS05935 | - | 1179124..1179618 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| NMJ60_RS05940 | - | 1179611..1180819 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| NMJ60_RS05945 | - | 1180833..1182251 (+) | 1419 | WP_225305868.1 | phage portal protein | - |
| NMJ60_RS05950 | - | 1182190..1183170 (+) | 981 | WP_001795666.1 | phage head morphogenesis protein | - |
| NMJ60_RS05955 | - | 1183268..1183864 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| NMJ60_RS05960 | - | 1183885..1184709 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| NMJ60_RS05965 | - | 1184726..1185052 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| NMJ60_RS05970 | - | 1185052..1185366 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| NMJ60_RS05975 | - | 1185359..1185694 (+) | 336 | WP_000482986.1 | phage head closure protein | - |
| NMJ60_RS05980 | - | 1185681..1186094 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| NMJ60_RS05985 | - | 1186107..1186544 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| NMJ60_RS05990 | - | 1186531..1187091 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| NMJ60_RS05995 | - | 1187153..1187647 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| NMJ60_RS06000 | - | 1187668..1188009 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| NMJ60_RS06005 | - | 1188012..1190981 (+) | 2970 | WP_044425803.1 | phage tail protein | - |
| NMJ60_RS06010 | - | 1190996..1191931 (+) | 936 | WP_000560196.1 | phage tail domain-containing protein | - |
| NMJ60_RS06015 | - | 1191942..1193828 (+) | 1887 | WP_044425805.1 | SGNH/GDSL hydrolase family protein | - |
| NMJ60_RS06020 | - | 1193841..1195739 (+) | 1899 | WP_063664751.1 | hypothetical protein | - |
| NMJ60_RS06025 | - | 1195739..1197562 (+) | 1824 | WP_044425642.1 | phage baseplate upper protein | - |
| NMJ60_RS06030 | - | 1197562..1197969 (+) | 408 | WP_044425645.1 | DUF2977 domain-containing protein | - |
| NMJ60_RS06035 | - | 1197944..1198117 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| NMJ60_RS06040 | - | 1198158..1198457 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| NMJ60_RS14310 | - | 1198594..1198701 (+) | 108 | Protein_1184 | hypothetical protein | - |
| NMJ60_RS06045 | - | 1198950..1199570 (+) | 621 | WP_000355823.1 | AP2 domain-containing protein | - |
| NMJ60_RS06050 | - | 1199681..1201450 (+) | 1770 | Protein_1186 | glucosaminidase domain-containing protein | - |
| NMJ60_RS06055 | - | 1201463..1202635 (+) | 1173 | WP_044435510.1 | BppU family phage baseplate upper protein | - |
| NMJ60_RS06060 | - | 1202641..1203036 (+) | 396 | WP_044435513.1 | hypothetical protein | - |
| NMJ60_RS06065 | - | 1203092..1203529 (+) | 438 | WP_000354133.1 | phage holin | - |
| NMJ60_RS06070 | - | 1203510..1204955 (+) | 1446 | WP_069479479.1 | SH3 domain-containing protein | - |
| NMJ60_RS06075 | - | 1205198..1205350 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| NMJ60_RS06080 | - | 1205421..1205531 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| NMJ60_RS06085 | - | 1205533..1205718 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17747.64 Da Isoelectric Point: 4.9816
>NTDB_id=709632 NMJ60_RS05840 WP_000934768.1 1172472..1172942(+) (ssbA) [Staphylococcus aureus strain #492]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=709632 NMJ60_RS05840 WP_000934768.1 1172472..1172942(+) (ssbA) [Staphylococcus aureus strain #492]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |