Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M1E50_RS13895 | Genome accession | NZ_CP096274 |
| Coordinates | 2803353..2803823 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain FJ0322 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2780632..2808992 | 2803353..2803823 | within | 0 |
Gene organization within MGE regions
Location: 2780632..2808992
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1E50_RS13745 (M1E50_13725) | groES | 2780632..2780916 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| M1E50_RS13750 (M1E50_13730) | groL | 2780992..2782608 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| M1E50_RS13755 (M1E50_13735) | - | 2783139..2784446 (-) | 1308 | WP_001045085.1 | TrkH family potassium uptake protein | - |
| M1E50_RS13760 (M1E50_13740) | - | 2784607..2785518 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| M1E50_RS13765 (M1E50_13745) | - | 2785580..2786424 (+) | 845 | Protein_2671 | class I SAM-dependent methyltransferase | - |
| M1E50_RS13770 (M1E50_13750) | - | 2786797..2788020 (-) | 1224 | WP_000206635.1 | ArgE/DapE family deacylase | - |
| M1E50_RS13775 (M1E50_13755) | lukH | 2788456..2789508 (+) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| M1E50_RS13780 (M1E50_13760) | lukG | 2789530..2790546 (+) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| M1E50_RS13785 (M1E50_13765) | sph | 2791047..2791871 (-) | 825 | Protein_2675 | sphingomyelin phosphodiesterase | - |
| M1E50_RS13790 (M1E50_13770) | - | 2791928..2792965 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| M1E50_RS13795 (M1E50_13775) | - | 2793024..2793488 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| M1E50_RS13800 (M1E50_13780) | - | 2793588..2793770 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| M1E50_RS13805 (M1E50_13785) | - | 2793974..2794315 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| M1E50_RS13810 (M1E50_13790) | - | 2794321..2795253 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| M1E50_RS13815 (M1E50_13795) | - | 2795269..2795982 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| M1E50_RS13820 (M1E50_13800) | - | 2795945..2796118 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| M1E50_RS13825 (M1E50_13805) | - | 2796115..2796378 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| M1E50_RS13830 (M1E50_13810) | - | 2796394..2796609 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| M1E50_RS13835 (M1E50_13815) | - | 2796598..2796927 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| M1E50_RS13840 (M1E50_13820) | - | 2796978..2797730 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| M1E50_RS13845 (M1E50_13825) | - | 2797746..2797943 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| M1E50_RS13850 (M1E50_13830) | - | 2797930..2798310 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| M1E50_RS13855 (M1E50_13835) | - | 2798365..2798688 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| M1E50_RS13860 (M1E50_13840) | - | 2798685..2798846 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| M1E50_RS13865 (M1E50_13845) | - | 2798941..2799243 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| M1E50_RS13870 (M1E50_13850) | - | 2799248..2799508 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| M1E50_RS13875 (M1E50_13855) | - | 2799517..2799780 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| M1E50_RS13880 (M1E50_13860) | - | 2799789..2801732 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| M1E50_RS13885 (M1E50_13865) | - | 2801734..2802654 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| M1E50_RS13890 (M1E50_13870) | - | 2802735..2803352 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| M1E50_RS13895 (M1E50_13875) | ssbA | 2803353..2803823 (+) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| M1E50_RS13900 (M1E50_13880) | - | 2803853..2804746 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| M1E50_RS13905 (M1E50_13885) | - | 2804753..2804971 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| M1E50_RS13910 (M1E50_13890) | - | 2804980..2805384 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M1E50_RS13915 (M1E50_13895) | - | 2805397..2805765 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| M1E50_RS13920 (M1E50_13900) | - | 2805769..2806011 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| M1E50_RS13925 (M1E50_13905) | - | 2806026..2806274 (+) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| M1E50_RS13930 (M1E50_13910) | - | 2806267..2806803 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| M1E50_RS13935 (M1E50_13915) | - | 2806840..2807085 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| M1E50_RS13940 (M1E50_13920) | - | 2807082..2807288 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| M1E50_RS13945 (M1E50_13925) | - | 2807285..2807671 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| M1E50_RS13950 (M1E50_13930) | rinB | 2807668..2807817 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| M1E50_RS13955 (M1E50_13935) | - | 2807817..2808017 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| M1E50_RS13960 (M1E50_13940) | - | 2808045..2808461 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| M1E50_RS13965 (M1E50_13945) | - | 2808693..2808992 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=680854 M1E50_RS13895 WP_000934760.1 2803353..2803823(+) (ssbA) [Staphylococcus aureus strain FJ0322]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=680854 M1E50_RS13895 WP_000934760.1 2803353..2803823(+) (ssbA) [Staphylococcus aureus strain FJ0322]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |