Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M0D62_RS09980 | Genome accession | NZ_CP096114 |
| Coordinates | 2049473..2049943 (-) | Length | 156 a.a. |
| NCBI ID | WP_047437043.1 | Uniprot ID | - |
| Organism | Staphylococcus argenteus strain MRSA-139-14-168 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2048780..2103217 | 2049473..2049943 | within | 0 |
Gene organization within MGE regions
Location: 2048780..2103217
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0D62_RS09980 (M0D62_09970) | ssbA | 2049473..2049943 (-) | 471 | WP_047437043.1 | single-stranded DNA-binding protein | Machinery gene |
| M0D62_RS09985 (M0D62_09975) | - | 2049944..2050561 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| M0D62_RS09990 (M0D62_09980) | - | 2050642..2051562 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| M0D62_RS09995 (M0D62_09985) | - | 2051564..2053507 (-) | 1944 | WP_047437048.1 | AAA family ATPase | - |
| M0D62_RS10000 (M0D62_09990) | - | 2053516..2053779 (-) | 264 | WP_072292182.1 | hypothetical protein | - |
| M0D62_RS10005 (M0D62_09995) | - | 2053788..2054048 (-) | 261 | WP_047437050.1 | DUF1108 family protein | - |
| M0D62_RS10010 (M0D62_10000) | - | 2054053..2054355 (-) | 303 | WP_047437053.1 | DUF2482 family protein | - |
| M0D62_RS10015 (M0D62_10005) | - | 2054450..2054611 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| M0D62_RS10020 (M0D62_10010) | - | 2054608..2054928 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| M0D62_RS10025 (M0D62_10015) | - | 2054988..2055362 (+) | 375 | WP_047437056.1 | hypothetical protein | - |
| M0D62_RS10030 (M0D62_10020) | - | 2055367..2055561 (-) | 195 | WP_047437059.1 | hypothetical protein | - |
| M0D62_RS10035 | - | 2055625..2055840 (+) | 216 | WP_015977918.1 | hypothetical protein | - |
| M0D62_RS10040 (M0D62_10030) | - | 2056144..2056893 (-) | 750 | WP_047437065.1 | phage antirepressor KilAC domain-containing protein | - |
| M0D62_RS10045 (M0D62_10035) | - | 2056910..2057179 (-) | 270 | WP_047432554.1 | helix-turn-helix transcriptional regulator | - |
| M0D62_RS10050 (M0D62_10040) | - | 2057198..2057352 (-) | 155 | Protein_1913 | transcriptional regulator | - |
| M0D62_RS10055 (M0D62_10045) | - | 2057315..2058028 (+) | 714 | WP_031768797.1 | XRE family transcriptional regulator | - |
| M0D62_RS10060 (M0D62_10050) | - | 2058046..2058660 (+) | 615 | WP_047437068.1 | hypothetical protein | - |
| M0D62_RS10065 (M0D62_10055) | - | 2058855..2059022 (+) | 168 | WP_047437071.1 | hypothetical protein | - |
| M0D62_RS10070 (M0D62_10060) | - | 2059320..2060393 (+) | 1074 | WP_047437187.1 | Abi family protein | - |
| M0D62_RS10075 (M0D62_10065) | - | 2060453..2061490 (+) | 1038 | WP_000857198.1 | site-specific integrase | - |
| M0D62_RS10080 (M0D62_10070) | sph | 2061541..2062371 (+) | 831 | Protein_1919 | sphingomyelin phosphodiesterase | - |
| M0D62_RS10085 (M0D62_10075) | - | 2062743..2062883 (-) | 141 | WP_190317128.1 | hypothetical protein | - |
| M0D62_RS10090 (M0D62_10080) | - | 2062939..2063955 (-) | 1017 | WP_047437076.1 | leukocidin/hemolysin toxin family protein | - |
| M0D62_RS10095 (M0D62_10085) | - | 2063977..2065032 (-) | 1056 | WP_047437079.1 | leukocidin/hemolysin toxin family protein | - |
| M0D62_RS10100 (M0D62_10090) | - | 2065460..2066683 (+) | 1224 | WP_047437082.1 | ArgE/DapE family deacylase | - |
| M0D62_RS10105 (M0D62_10095) | - | 2067301..2068608 (+) | 1308 | WP_047437088.1 | TrkH family potassium uptake protein | - |
| M0D62_RS10110 (M0D62_10100) | - | 2069577..2070020 (-) | 444 | WP_047437091.1 | GNAT family N-acetyltransferase | - |
| M0D62_RS10115 (M0D62_10105) | - | 2070134..2070526 (-) | 393 | WP_170963202.1 | DUF1433 domain-containing protein | - |
| M0D62_RS10120 (M0D62_10110) | - | 2070553..2071764 (+) | 1212 | WP_047437095.1 | hypothetical protein | - |
| M0D62_RS10125 (M0D62_10115) | - | 2071766..2072155 (+) | 390 | WP_047437098.1 | hypothetical protein | - |
| M0D62_RS10130 (M0D62_10120) | - | 2072363..2072673 (+) | 311 | Protein_1929 | tyrosine-type recombinase/integrase | - |
| M0D62_RS10135 (M0D62_10125) | groL | 2072787..2074403 (-) | 1617 | WP_047437101.1 | chaperonin GroEL | - |
| M0D62_RS10140 (M0D62_10130) | groES | 2074475..2074759 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| M0D62_RS10145 (M0D62_10135) | mroQ | 2074936..2075679 (+) | 744 | WP_047437105.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| M0D62_RS10150 (M0D62_10140) | - | 2075705..2076925 (-) | 1221 | WP_047437108.1 | SdrH family protein | - |
| M0D62_RS10155 (M0D62_10145) | - | 2077121..2077747 (+) | 627 | WP_047437110.1 | nitroreductase family protein | - |
| M0D62_RS10160 (M0D62_10150) | - | 2077848..2078633 (+) | 786 | WP_047437112.1 | carbon-nitrogen family hydrolase | - |
| M0D62_RS13595 | - | 2079153..2079287 (-) | 135 | WP_001823225.1 | delta-lysin family phenol-soluble modulin | - |
| M0D62_RS10170 (M0D62_10160) | - | 2079523..2080086 (+) | 564 | WP_047437114.1 | accessory gene regulator AgrB | - |
| M0D62_RS10175 (M0D62_10165) | - | 2080090..2080230 (+) | 141 | WP_047437117.1 | cyclic lactone autoinducer peptide | - |
| M0D62_RS10180 (M0D62_10170) | - | 2080255..2081547 (+) | 1293 | WP_047437119.1 | GHKL domain-containing protein | - |
| M0D62_RS10185 (M0D62_10175) | agrA | 2081566..2082282 (+) | 717 | WP_047437122.1 | LytTR family DNA-binding domain-containing protein | Regulator |
| M0D62_RS10190 (M0D62_10180) | - | 2082635..2083594 (-) | 960 | WP_047437124.1 | carbohydrate kinase | - |
| M0D62_RS10195 (M0D62_10185) | - | 2083591..2085075 (-) | 1485 | WP_047437127.1 | sucrose-6-phosphate hydrolase | - |
| M0D62_RS10200 (M0D62_10190) | - | 2085224..2086174 (-) | 951 | WP_000790316.1 | LacI family DNA-binding transcriptional regulator | - |
| M0D62_RS10205 (M0D62_10195) | - | 2086345..2087595 (-) | 1251 | WP_047437132.1 | ammonium transporter | - |
| M0D62_RS10210 (M0D62_10200) | - | 2087810..2088034 (-) | 225 | WP_000638824.1 | sulfurtransferase TusA family protein | - |
| M0D62_RS10215 (M0D62_10205) | - | 2088109..2089170 (-) | 1062 | WP_047437137.1 | YeeE/YedE family protein | - |
| M0D62_RS10220 (M0D62_10210) | - | 2089468..2090103 (-) | 636 | WP_001283609.1 | redox-sensing transcriptional repressor Rex | - |
| M0D62_RS10225 (M0D62_10215) | - | 2090357..2092285 (+) | 1929 | WP_248129740.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| M0D62_RS10230 (M0D62_10220) | - | 2092647..2094257 (+) | 1611 | WP_047437142.1 | MutS family DNA mismatch repair protein | - |
| M0D62_RS10235 (M0D62_10225) | tsaD | 2094358..2095383 (-) | 1026 | WP_047437145.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD | - |
| M0D62_RS10240 (M0D62_10230) | rimI | 2095376..2095840 (-) | 465 | WP_000372752.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
| M0D62_RS10245 (M0D62_10235) | tsaB | 2095813..2096475 (-) | 663 | WP_047437148.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| M0D62_RS10250 (M0D62_10240) | tsaE | 2096456..2096917 (-) | 462 | WP_047437151.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| M0D62_RS10255 (M0D62_10245) | - | 2096954..2097103 (+) | 150 | Protein_1954 | hypothetical protein | - |
| M0D62_RS10260 (M0D62_10250) | ilvD | 2097435..2099123 (+) | 1689 | WP_001255776.1 | dihydroxy-acid dehydratase | - |
| M0D62_RS10265 (M0D62_10255) | ilvB | 2099141..2100910 (+) | 1770 | WP_047437191.1 | biosynthetic-type acetolactate synthase large subunit | - |
| M0D62_RS10270 (M0D62_10260) | - | 2100910..2101164 (+) | 255 | WP_000196758.1 | ACT domain-containing protein | - |
| M0D62_RS10275 (M0D62_10265) | ilvC | 2101303..2102307 (+) | 1005 | WP_000214552.1 | ketol-acid reductoisomerase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17693.65 Da Isoelectric Point: 8.3520
>NTDB_id=679429 M0D62_RS09980 WP_047437043.1 2049473..2049943(-) (ssbA) [Staphylococcus argenteus strain MRSA-139-14-168]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVAHSIQFLEPKNTNDNQQDLYQKQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVAHSIQFLEPKNTNDNQQDLYQKQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=679429 M0D62_RS09980 WP_047437043.1 2049473..2049943(-) (ssbA) [Staphylococcus argenteus strain MRSA-139-14-168]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCGCAAGGAGAACGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCCATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAAAAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCGCAAGGAGAACGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCCATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAAAAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |
| ssb | Neisseria meningitidis MC58 |
34.104 |
100 |
0.378 |
| ssb | Neisseria gonorrhoeae MS11 |
34.104 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.844 |
100 |
0.365 |