Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MTO98_RS33925 | Genome accession | NZ_CP094527 |
| Coordinates | 8069855..8070187 (+) | Length | 110 a.a. |
| NCBI ID | WP_243484227.1 | Uniprot ID | - |
| Organism | Mucilaginibacter sp. SMC90 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 8038208..8077400 | 8069855..8070187 | within | 0 |
Gene organization within MGE regions
Location: 8038208..8077400
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTO98_RS34355 | - | 8038679..8038801 (-) | 123 | WP_256464348.1 | hypothetical protein | - |
| MTO98_RS33750 (MTO98_33750) | - | 8039054..8039275 (-) | 222 | WP_243484155.1 | hypothetical protein | - |
| MTO98_RS33755 (MTO98_33755) | - | 8039474..8039767 (-) | 294 | WP_243484157.1 | hypothetical protein | - |
| MTO98_RS33760 (MTO98_33760) | - | 8039824..8040264 (-) | 441 | WP_243484158.1 | Hsp20/alpha crystallin family protein | - |
| MTO98_RS33765 (MTO98_33765) | - | 8040621..8041097 (+) | 477 | WP_243484160.1 | MgtC/SapB family protein | - |
| MTO98_RS33770 (MTO98_33770) | - | 8041123..8042013 (+) | 891 | WP_243484162.1 | bestrophin family protein | - |
| MTO98_RS33775 (MTO98_33775) | - | 8042825..8044252 (-) | 1428 | WP_243484163.1 | TolC family protein | - |
| MTO98_RS33780 (MTO98_33780) | - | 8044264..8047473 (-) | 3210 | WP_243484165.1 | efflux RND transporter permease subunit | - |
| MTO98_RS33785 (MTO98_33785) | - | 8047593..8048732 (-) | 1140 | WP_243484167.1 | efflux RND transporter periplasmic adaptor subunit | - |
| MTO98_RS33790 (MTO98_33790) | - | 8048825..8049424 (-) | 600 | WP_243484169.1 | TetR/AcrR family transcriptional regulator | - |
| MTO98_RS33795 (MTO98_33795) | - | 8049741..8050946 (-) | 1206 | WP_243484171.1 | MFS transporter | - |
| MTO98_RS33800 (MTO98_33800) | - | 8051038..8051892 (-) | 855 | WP_243484173.1 | AraC family transcriptional regulator | - |
| MTO98_RS33805 (MTO98_33805) | - | 8052614..8053036 (+) | 423 | WP_243484175.1 | helix-turn-helix transcriptional regulator | - |
| MTO98_RS33810 (MTO98_33810) | - | 8053624..8054226 (-) | 603 | WP_243484177.1 | hypothetical protein | - |
| MTO98_RS33815 (MTO98_33815) | - | 8054265..8055245 (-) | 981 | WP_243484179.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MTO98_RS33820 (MTO98_33820) | mobC | 8055235..8055612 (-) | 378 | WP_243484182.1 | plasmid mobilization relaxosome protein MobC | - |
| MTO98_RS33825 (MTO98_33825) | - | 8055819..8056736 (-) | 918 | WP_243484184.1 | toprim domain-containing protein | - |
| MTO98_RS33830 (MTO98_33830) | - | 8056989..8057183 (-) | 195 | WP_243484185.1 | hypothetical protein | - |
| MTO98_RS33835 (MTO98_33835) | - | 8057171..8058214 (-) | 1044 | WP_243484187.1 | primase-helicase family protein | - |
| MTO98_RS33840 (MTO98_33840) | - | 8058223..8058510 (-) | 288 | WP_243484190.1 | helix-turn-helix domain-containing protein | - |
| MTO98_RS33845 (MTO98_33845) | - | 8058582..8059736 (-) | 1155 | WP_243484193.1 | hypothetical protein | - |
| MTO98_RS33850 (MTO98_33850) | - | 8060224..8060961 (+) | 738 | WP_243484195.1 | hypothetical protein | - |
| MTO98_RS33855 (MTO98_33855) | - | 8061028..8061819 (-) | 792 | WP_243484197.1 | PKD domain-containing protein | - |
| MTO98_RS33860 (MTO98_33860) | - | 8061998..8062234 (-) | 237 | WP_243484199.1 | helix-turn-helix domain-containing protein | - |
| MTO98_RS33865 (MTO98_33865) | - | 8062398..8062547 (-) | 150 | WP_243484202.1 | hypothetical protein | - |
| MTO98_RS33870 (MTO98_33870) | - | 8062855..8063121 (+) | 267 | WP_243484204.1 | helix-turn-helix transcriptional regulator | - |
| MTO98_RS33875 (MTO98_33875) | - | 8063605..8064315 (-) | 711 | WP_243484205.1 | PAS domain-containing protein | - |
| MTO98_RS33880 (MTO98_33880) | - | 8064691..8065548 (+) | 858 | WP_243484207.1 | phosphatase PAP2 family protein | - |
| MTO98_RS33885 (MTO98_33885) | - | 8065750..8065983 (-) | 234 | WP_243484209.1 | helix-turn-helix transcriptional regulator | - |
| MTO98_RS33890 (MTO98_33890) | - | 8066371..8066643 (-) | 273 | WP_243484211.1 | hypothetical protein | - |
| MTO98_RS33895 (MTO98_33895) | - | 8066706..8066972 (-) | 267 | WP_243484213.1 | helix-turn-helix domain-containing protein | - |
| MTO98_RS33900 (MTO98_33900) | - | 8067412..8067675 (-) | 264 | WP_243484215.1 | hypothetical protein | - |
| MTO98_RS33905 (MTO98_33905) | - | 8067889..8068158 (+) | 270 | WP_243484218.1 | hypothetical protein | - |
| MTO98_RS33910 (MTO98_33910) | - | 8068179..8068448 (-) | 270 | WP_243484220.1 | helix-turn-helix domain-containing protein | - |
| MTO98_RS33915 (MTO98_33915) | - | 8068950..8069225 (-) | 276 | WP_243484222.1 | hypothetical protein | - |
| MTO98_RS33920 (MTO98_33920) | - | 8069313..8069684 (+) | 372 | WP_243484225.1 | PleD family two-component system response regulator | - |
| MTO98_RS33925 (MTO98_33925) | ssb | 8069855..8070187 (+) | 333 | WP_243484227.1 | single-stranded DNA-binding protein | Machinery gene |
| MTO98_RS33930 (MTO98_33930) | - | 8070436..8071458 (-) | 1023 | WP_243484229.1 | ABC transporter permease | - |
| MTO98_RS33935 (MTO98_33935) | - | 8071385..8072386 (-) | 1002 | WP_243484231.1 | ABC transporter ATP-binding protein | - |
| MTO98_RS33940 (MTO98_33940) | - | 8072373..8073227 (-) | 855 | WP_243484234.1 | NEW3 domain-containing protein | - |
| MTO98_RS33945 (MTO98_33945) | - | 8073407..8074081 (+) | 675 | WP_243484236.1 | PAS domain-containing protein | - |
| MTO98_RS33950 (MTO98_33950) | - | 8074535..8075905 (-) | 1371 | WP_243484238.1 | RNA-binding domain-containing protein | - |
| MTO98_RS33955 (MTO98_33955) | - | 8075995..8076435 (-) | 441 | WP_243484240.1 | tyrosine-type recombinase/integrase | - |
| MTO98_RS33960 (MTO98_33960) | - | 8076413..8077141 (-) | 729 | WP_243484242.1 | phage integrase SAM-like domain and Arm DNA-binding domain-containing protein | - |
Sequence
Protein
Download Length: 110 a.a. Molecular weight: 12258.07 Da Isoelectric Point: 9.5500
>NTDB_id=670017 MTO98_RS33925 WP_243484227.1 8069855..8070187(+) (ssb) [Mucilaginibacter sp. SMC90]
MAGINKVFLAGHLGKDPDLRYLDNGVAVSSFPLATSEITGRGEQQKAVTEWHNIVMWRSLAERSVQLKKGQLVYIEGKIR
TRNIIDRTGLKKYVTEISADHFEVLGGQCS
MAGINKVFLAGHLGKDPDLRYLDNGVAVSSFPLATSEITGRGEQQKAVTEWHNIVMWRSLAERSVQLKKGQLVYIEGKIR
TRNIIDRTGLKKYVTEISADHFEVLGGQCS
Nucleotide
Download Length: 333 bp
>NTDB_id=670017 MTO98_RS33925 WP_243484227.1 8069855..8070187(+) (ssb) [Mucilaginibacter sp. SMC90]
ATGGCTGGTATTAATAAGGTGTTTTTAGCCGGTCATTTAGGCAAAGACCCGGATTTACGTTATCTCGATAATGGCGTCGC
CGTCTCATCCTTCCCACTTGCAACATCGGAAATAACCGGCAGAGGGGAGCAGCAAAAAGCTGTCACCGAATGGCATAACA
TAGTCATGTGGCGATCTTTGGCGGAAAGGTCAGTACAGCTAAAAAAAGGTCAACTTGTTTATATCGAAGGGAAGATACGT
ACACGAAATATCATAGATCGAACTGGCCTTAAGAAATACGTAACGGAAATATCGGCTGACCACTTTGAAGTACTCGGCGG
ACAATGTTCCTAA
ATGGCTGGTATTAATAAGGTGTTTTTAGCCGGTCATTTAGGCAAAGACCCGGATTTACGTTATCTCGATAATGGCGTCGC
CGTCTCATCCTTCCCACTTGCAACATCGGAAATAACCGGCAGAGGGGAGCAGCAAAAAGCTGTCACCGAATGGCATAACA
TAGTCATGTGGCGATCTTTGGCGGAAAGGTCAGTACAGCTAAAAAAAGGTCAACTTGTTTATATCGAAGGGAAGATACGT
ACACGAAATATCATAGATCGAACTGGCCTTAAGAAATACGTAACGGAAATATCGGCTGACCACTTTGAAGTACTCGGCGG
ACAATGTTCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
45.69 |
100 |
0.482 |
| ssb | Neisseria meningitidis MC58 |
47.664 |
97.273 |
0.464 |
| ssb | Neisseria gonorrhoeae MS11 |
47.664 |
97.273 |
0.464 |
| ssb | Vibrio cholerae strain A1552 |
41.739 |
100 |
0.436 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
39.423 |
94.545 |
0.373 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
39.423 |
94.545 |
0.373 |