Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MQP46_RS10520 | Genome accession | NZ_CP093935 |
| Coordinates | 2095193..2095663 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain WA121-2021_16354 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2065838..2117315 | 2095193..2095663 | within | 0 |
Gene organization within MGE regions
Location: 2065838..2117315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQP46_RS10305 (MQP46_10305) | scn | 2065838..2066188 (-) | 351 | WP_103150232.1 | complement inhibitor SCIN-A | - |
| MQP46_RS10310 (MQP46_10310) | - | 2066873..2067322 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| MQP46_RS10315 (MQP46_10315) | - | 2067417..2067752 (-) | 336 | Protein_1998 | SH3 domain-containing protein | - |
| MQP46_RS10320 (MQP46_10320) | sak | 2068402..2068893 (-) | 492 | WP_000920037.1 | staphylokinase | - |
| MQP46_RS10325 (MQP46_10325) | - | 2069085..2069840 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| MQP46_RS10330 (MQP46_10330) | - | 2069852..2070106 (-) | 255 | WP_000611512.1 | phage holin | - |
| MQP46_RS10335 (MQP46_10335) | - | 2070158..2070265 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| MQP46_RS10340 (MQP46_10340) | pepG1 | 2070318..2070452 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| MQP46_RS10345 (MQP46_10345) | - | 2070644..2070940 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| MQP46_RS10350 (MQP46_10350) | - | 2070998..2071285 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| MQP46_RS10355 (MQP46_10355) | - | 2071332..2071484 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| MQP46_RS10360 (MQP46_10360) | - | 2071474..2075259 (-) | 3786 | WP_103150169.1 | phage tail spike protein | - |
| MQP46_RS10365 (MQP46_10365) | - | 2075275..2076759 (-) | 1485 | WP_000567393.1 | phage tail domain-containing protein | - |
| MQP46_RS10370 (MQP46_10370) | - | 2076756..2081300 (-) | 4545 | WP_000504564.1 | phage tail tape measure protein | - |
| MQP46_RS10375 (MQP46_10375) | - | 2081357..2081494 (-) | 138 | WP_001837493.1 | hypothetical protein | - |
| MQP46_RS10380 (MQP46_10380) | - | 2081545..2081895 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| MQP46_RS10385 (MQP46_10385) | - | 2081945..2082175 (-) | 231 | Protein_2012 | Ig-like domain-containing protein | - |
| MQP46_RS10390 (MQP46_10390) | - | 2082211..2082855 (-) | 645 | WP_000268740.1 | major tail protein | - |
| MQP46_RS10395 (MQP46_10395) | - | 2082856..2083263 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| MQP46_RS10400 (MQP46_10400) | - | 2083260..2083664 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| MQP46_RS10405 (MQP46_10405) | - | 2083661..2084023 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| MQP46_RS10410 (MQP46_10410) | - | 2084007..2084291 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| MQP46_RS10415 (MQP46_10415) | - | 2084281..2084565 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| MQP46_RS10420 (MQP46_10420) | - | 2084585..2085730 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| MQP46_RS10425 (MQP46_10425) | - | 2085754..2086491 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| MQP46_RS10430 (MQP46_10430) | - | 2086475..2087662 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| MQP46_RS10435 (MQP46_10435) | - | 2087678..2089339 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| MQP46_RS10440 (MQP46_10440) | - | 2089336..2089680 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| MQP46_RS10445 (MQP46_10445) | - | 2089810..2090109 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| MQP46_RS10450 (MQP46_10450) | - | 2090341..2090757 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| MQP46_RS10455 (MQP46_10455) | - | 2090785..2090985 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| MQP46_RS10460 (MQP46_10460) | - | 2090985..2091134 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MQP46_RS10465 (MQP46_10465) | - | 2091131..2091517 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| MQP46_RS10470 (MQP46_10470) | - | 2091514..2091720 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| MQP46_RS10475 (MQP46_10475) | - | 2091717..2091962 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| MQP46_RS10480 (MQP46_10480) | - | 2091999..2092535 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| MQP46_RS10485 (MQP46_10485) | - | 2092528..2092698 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| MQP46_RS10490 (MQP46_10490) | - | 2092685..2092939 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| MQP46_RS10495 (MQP46_10495) | - | 2092954..2093196 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| MQP46_RS10500 (MQP46_10500) | - | 2093200..2093568 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| MQP46_RS10505 (MQP46_10505) | - | 2093581..2094036 (-) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MQP46_RS10510 (MQP46_10510) | - | 2094045..2094263 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| MQP46_RS10515 (MQP46_10515) | - | 2094270..2095163 (-) | 894 | WP_103150168.1 | DnaD domain-containing protein | - |
| MQP46_RS10520 (MQP46_10520) | ssbA | 2095193..2095663 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| MQP46_RS10525 (MQP46_10525) | - | 2095664..2096281 (-) | 618 | WP_103150167.1 | MBL fold metallo-hydrolase | - |
| MQP46_RS10530 (MQP46_10530) | - | 2096362..2097282 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| MQP46_RS10535 (MQP46_10535) | - | 2097284..2099227 (-) | 1944 | WP_103150170.1 | AAA family ATPase | - |
| MQP46_RS10540 (MQP46_10540) | - | 2099236..2099499 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| MQP46_RS10545 (MQP46_10545) | - | 2099508..2099768 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| MQP46_RS10550 (MQP46_10550) | - | 2099773..2100075 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| MQP46_RS10555 (MQP46_10555) | - | 2100170..2100331 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| MQP46_RS10560 (MQP46_10560) | - | 2100328..2100651 (-) | 324 | WP_103150166.1 | DUF771 domain-containing protein | - |
| MQP46_RS10565 (MQP46_10565) | - | 2100706..2101086 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| MQP46_RS10570 (MQP46_10570) | - | 2101073..2101270 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| MQP46_RS10575 (MQP46_10575) | - | 2101286..2102035 (-) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| MQP46_RS10580 (MQP46_10580) | - | 2102092..2102631 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| MQP46_RS10585 (MQP46_10585) | - | 2102655..2102915 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| MQP46_RS10590 (MQP46_10590) | - | 2102933..2103157 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| MQP46_RS10595 (MQP46_10595) | - | 2103316..2104086 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| MQP46_RS10600 (MQP46_10600) | - | 2104182..2106092 (+) | 1911 | WP_031826882.1 | N-6 DNA methylase | - |
| MQP46_RS10605 (MQP46_10605) | - | 2106073..2107086 (+) | 1014 | WP_031826883.1 | restriction endonuclease subunit S | - |
| MQP46_RS10610 (MQP46_10610) | - | 2107140..2108177 (+) | 1038 | WP_031887148.1 | site-specific integrase | - |
| MQP46_RS10615 (MQP46_10615) | sph | 2108228..2109058 (+) | 831 | Protein_2058 | sphingomyelin phosphodiesterase | - |
| MQP46_RS10620 (MQP46_10620) | lukG | 2109296..2110312 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| MQP46_RS10625 (MQP46_10625) | lukH | 2110334..2111389 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| MQP46_RS10630 (MQP46_10630) | - | 2111825..2113048 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| MQP46_RS10635 (MQP46_10635) | - | 2113492..2114799 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| MQP46_RS10640 (MQP46_10640) | groL | 2115339..2116955 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| MQP46_RS10645 (MQP46_10645) | groES | 2117031..2117315 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=665737 MQP46_RS10520 WP_000934760.1 2095193..2095663(-) (ssbA) [Staphylococcus aureus strain WA121-2021_16354]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=665737 MQP46_RS10520 WP_000934760.1 2095193..2095663(-) (ssbA) [Staphylococcus aureus strain WA121-2021_16354]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |