Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MNU32_RS10070 | Genome accession | NZ_CP093212 |
| Coordinates | 2081440..2081913 (-) | Length | 157 a.a. |
| NCBI ID | WP_059223501.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain TSM-51 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2047204..2091748 | 2081440..2081913 | within | 0 |
Gene organization within MGE regions
Location: 2047204..2091748
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU32_RS09855 (MNU32_09855) | - | 2047204..2047545 (-) | 342 | WP_002456621.1 | fatty acid desaturase | - |
| MNU32_RS09860 (MNU32_09860) | - | 2047758..2047994 (-) | 237 | WP_001829451.1 | hypothetical protein | - |
| MNU32_RS13480 (MNU32_09865) | mobV | 2048196..2048756 (-) | 561 | Protein_1922 | MobV family relaxase | - |
| MNU32_RS09875 (MNU32_09875) | - | 2051085..2051744 (-) | 660 | WP_194086754.1 | hypothetical protein | - |
| MNU32_RS09880 (MNU32_09880) | - | 2051752..2052117 (-) | 366 | WP_194086753.1 | hypothetical protein | - |
| MNU32_RS09885 (MNU32_09885) | - | 2052086..2053003 (-) | 918 | WP_194086752.1 | ParA family protein | - |
| MNU32_RS09890 (MNU32_09890) | - | 2053490..2054953 (-) | 1464 | WP_254104868.1 | SH3 domain-containing protein | - |
| MNU32_RS09895 (MNU32_09895) | - | 2054928..2055338 (-) | 411 | WP_254104865.1 | phage holin | - |
| MNU32_RS09900 (MNU32_09900) | - | 2055402..2055800 (-) | 399 | WP_254104863.1 | YxeA family protein | - |
| MNU32_RS09905 (MNU32_09905) | - | 2055958..2056365 (-) | 408 | WP_059223927.1 | hypothetical protein | - |
| MNU32_RS09910 (MNU32_09910) | - | 2056352..2056777 (-) | 426 | WP_002456415.1 | hypothetical protein | - |
| MNU32_RS09915 (MNU32_09915) | - | 2056774..2057397 (-) | 624 | WP_059223933.1 | poly-gamma-glutamate hydrolase family protein | - |
| MNU32_RS09920 (MNU32_09920) | - | 2057402..2058616 (-) | 1215 | WP_254104861.1 | BppU family phage baseplate upper protein | - |
| MNU32_RS09925 (MNU32_09925) | - | 2058616..2060478 (-) | 1863 | WP_254104859.1 | M14 family metallopeptidase | - |
| MNU32_RS09930 (MNU32_09930) | - | 2060494..2060667 (-) | 174 | WP_254104856.1 | hypothetical protein | - |
| MNU32_RS09935 (MNU32_09935) | - | 2060660..2062219 (-) | 1560 | WP_254105925.1 | prophage endopeptidase tail family protein | - |
| MNU32_RS09940 (MNU32_09940) | - | 2062229..2063062 (-) | 834 | WP_059223520.1 | phage tail domain-containing protein | - |
| MNU32_RS09945 (MNU32_09945) | - | 2063064..2067776 (-) | 4713 | WP_254104851.1 | phage tail tape measure protein | - |
| MNU32_RS09950 (MNU32_09950) | - | 2067805..2068320 (-) | 516 | WP_059223518.1 | hypothetical protein | - |
| MNU32_RS09955 (MNU32_09955) | - | 2068336..2068695 (-) | 360 | WP_059223517.1 | hypothetical protein | - |
| MNU32_RS09960 (MNU32_09960) | - | 2068759..2068944 (-) | 186 | WP_002503473.1 | hypothetical protein | - |
| MNU32_RS09965 (MNU32_09965) | - | 2068963..2069592 (-) | 630 | WP_059223516.1 | major tail protein | - |
| MNU32_RS09970 (MNU32_09970) | - | 2069605..2070009 (-) | 405 | WP_100481682.1 | hypothetical protein | - |
| MNU32_RS09975 (MNU32_09975) | - | 2070012..2070278 (-) | 267 | WP_080356004.1 | hypothetical protein | - |
| MNU32_RS09980 (MNU32_09980) | - | 2070413..2070742 (-) | 330 | WP_100481683.1 | head-tail adaptor protein | - |
| MNU32_RS09985 (MNU32_09985) | - | 2070732..2071073 (-) | 342 | WP_070840824.1 | head-tail connector protein | - |
| MNU32_RS09990 (MNU32_09990) | - | 2071092..2072450 (-) | 1359 | WP_059223512.1 | phage major capsid protein | - |
| MNU32_RS09995 (MNU32_09995) | - | 2072490..2073047 (-) | 558 | WP_059223511.1 | HK97 family phage prohead protease | - |
| MNU32_RS10000 (MNU32_10000) | - | 2073037..2074269 (-) | 1233 | WP_059223510.1 | phage portal protein | - |
| MNU32_RS10005 (MNU32_10005) | - | 2074272..2074466 (-) | 195 | WP_002500102.1 | hypothetical protein | - |
| MNU32_RS10010 (MNU32_10010) | - | 2074478..2076229 (-) | 1752 | WP_194086743.1 | terminase TerL endonuclease subunit | - |
| MNU32_RS10015 (MNU32_10015) | - | 2076222..2076692 (-) | 471 | WP_002484733.1 | phage terminase small subunit P27 family | - |
| MNU32_RS10020 (MNU32_10020) | - | 2076835..2077185 (-) | 351 | WP_083315469.1 | HNH endonuclease signature motif containing protein | - |
| MNU32_RS10025 (MNU32_10025) | - | 2077781..2078227 (-) | 447 | WP_059223508.1 | transcriptional regulator | - |
| MNU32_RS10030 (MNU32_10030) | - | 2078244..2078393 (-) | 150 | WP_002484731.1 | DUF1514 family protein | - |
| MNU32_RS10035 (MNU32_10035) | - | 2078393..2078560 (-) | 168 | WP_059223507.1 | regulator | - |
| MNU32_RS10040 (MNU32_10040) | - | 2078665..2078967 (+) | 303 | WP_059223506.1 | DUF4870 domain-containing protein | - |
| MNU32_RS10045 (MNU32_10045) | dut | 2079063..2079485 (-) | 423 | WP_252918107.1 | dUTP diphosphatase | - |
| MNU32_RS10050 (MNU32_10050) | - | 2079542..2079859 (+) | 318 | WP_228064100.1 | hypothetical protein | - |
| MNU32_RS10055 (MNU32_10055) | - | 2079869..2080075 (-) | 207 | WP_059223504.1 | hypothetical protein | - |
| MNU32_RS10060 (MNU32_10060) | - | 2080076..2080483 (-) | 408 | WP_059223503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MNU32_RS10065 (MNU32_10065) | - | 2080523..2081410 (-) | 888 | WP_059223502.1 | DnaD domain-containing protein | - |
| MNU32_RS10070 (MNU32_10070) | ssbA | 2081440..2081913 (-) | 474 | WP_059223501.1 | single-stranded DNA-binding protein | Machinery gene |
| MNU32_RS10075 (MNU32_10075) | - | 2081914..2082531 (-) | 618 | WP_254104909.1 | MBL fold metallo-hydrolase | - |
| MNU32_RS10080 (MNU32_10080) | - | 2082612..2083535 (-) | 924 | WP_059223500.1 | recombinase RecT | - |
| MNU32_RS10085 (MNU32_10085) | - | 2083537..2085489 (-) | 1953 | WP_194086741.1 | AAA family ATPase | - |
| MNU32_RS10090 (MNU32_10090) | - | 2085822..2086088 (+) | 267 | WP_002456364.1 | hypothetical protein | - |
| MNU32_RS10095 (MNU32_10095) | - | 2086215..2086424 (-) | 210 | WP_001830281.1 | hypothetical protein | - |
| MNU32_RS10100 (MNU32_10100) | - | 2086437..2087153 (-) | 717 | WP_002468739.1 | phage repressor protein | - |
| MNU32_RS10105 (MNU32_10105) | - | 2087167..2087406 (-) | 240 | WP_194086740.1 | helix-turn-helix transcriptional regulator | - |
| MNU32_RS10110 (MNU32_10110) | - | 2087600..2087929 (+) | 330 | WP_002484747.1 | helix-turn-helix domain-containing protein | - |
| MNU32_RS10115 (MNU32_10115) | - | 2087942..2088403 (+) | 462 | WP_002484735.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MNU32_RS10120 (MNU32_10120) | - | 2088572..2088739 (+) | 168 | WP_002497581.1 | hypothetical protein | - |
| MNU32_RS10125 (MNU32_10125) | - | 2088743..2089900 (+) | 1158 | WP_164493043.1 | CapA family protein | - |
| MNU32_RS10130 (MNU32_10130) | - | 2090085..2090636 (+) | 552 | WP_103422871.1 | Ltp family lipoprotein | - |
| MNU32_RS10135 (MNU32_10135) | - | 2090699..2091748 (+) | 1050 | WP_001830299.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17654.35 Da Isoelectric Point: 4.7719
>NTDB_id=662585 MNU32_RS10070 WP_059223501.1 2081440..2081913(-) (ssbA) [Staphylococcus epidermidis strain TSM-51]
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNANGEREADFINVITFRKQAVNVNEYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNANGEREADFINVITFRKQAVNVNEYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF
Nucleotide
Download Length: 474 bp
>NTDB_id=662585 MNU32_RS10070 WP_059223501.1 2081440..2081913(-) (ssbA) [Staphylococcus epidermidis strain TSM-51]
ATGATTAATAGAGTTGTATTAGTAGGTAGATTGACTAAAGATCCAGAGTTTAGAACAACGCCTAACGGTGTTGAAGTGAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCTAATGGAGAACGAGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAACGAGTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAATTTTTGTCACTGAAGTTGTCGCAGATAGTGTTCAATTTCTCGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA
ATGATTAATAGAGTTGTATTAGTAGGTAGATTGACTAAAGATCCAGAGTTTAGAACAACGCCTAACGGTGTTGAAGTGAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCTAATGGAGAACGAGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAACGAGTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAATTTTTGTCACTGAAGTTGTCGCAGATAGTGTTCAATTTCTCGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.65 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.548 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
67.516 |
0.389 |
| ssb | Neisseria meningitidis MC58 |
34.682 |
100 |
0.382 |
| ssb | Neisseria gonorrhoeae MS11 |
34.682 |
100 |
0.382 |
| ssb | Vibrio cholerae strain A1552 |
32.759 |
100 |
0.363 |