Detailed information NTG0656501

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: MIH18_RS07660
• Genome accession: NZ_CP092284
• Coordinates: 1659035..1659469 (+)
• Length: 144 a.a.
• NCBI ID: WP_283164857.1
• Uniprot ID: -
• Organism: Marinobacter sp. M3C
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1654035..1664469

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MIH18_RS07600 (MIH18_07595)	bamE	1654346..1654819 (+)	474	WP_249007824.1	outer membrane protein assembly factor BamE	-
MIH18_RS07605 (MIH18_07600)	-	1654929..1655117 (-)	189	Protein_1501	ATP-binding protein	-
MIH18_RS07610 (MIH18_07605)	-	1655260..1655379 (+)	120	Protein_1502	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH18_RS07615 (MIH18_07610)	-	1655411..1655791 (-)	381	WP_249007823.1	helix-turn-helix transcriptional regulator	-
MIH18_RS07620 (MIH18_07615)	-	1655909..1656211 (-)	303	WP_249007822.1	helix-turn-helix domain-containing protein	-
MIH18_RS24035	-	1656213..1656368 (-)	156	WP_349292903.1	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH18_RS07630 (MIH18_07625)	-	1656566..1656865 (-)	300	WP_249014241.1	type II toxin-antitoxin system RelE/ParE family toxin	-
MIH18_RS07635 (MIH18_07630)	-	1656862..1657128 (-)	267	WP_249007820.1	YlcI/YnfO family protein	-
MIH18_RS07640 (MIH18_07635)	-	1657263..1657805 (+)	543	WP_249007819.1	hypothetical protein	-
MIH18_RS07645 (MIH18_07640)	-	1657910..1658092 (+)	183	WP_249007818.1	type II toxin-antitoxin system HicA family toxin	-
MIH18_RS07650 (MIH18_07645)	-	1658133..1658564 (+)	432	WP_249014242.1	type II toxin-antitoxin system HicB family antitoxin	-
MIH18_RS07660 (MIH18_07655)	pilA2	1659035..1659469 (+)	435	WP_283164857.1	pilin	Machinery gene
MIH18_RS07665 (MIH18_07660)	-	1659594..1661504 (+)	1911	WP_249014243.1	tetratricopeptide repeat protein	-
MIH18_RS07670 (MIH18_07665)	-	1661519..1662373 (+)	855	WP_249014244.1	glycosyltransferase family 2 protein	-
MIH18_RS07675 (MIH18_07670)	-	1662790..1663929 (+)	1140	WP_283164858.1	glycosyltransferase family 4 protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 15079.13 Da
• Isoelectric Point: 4.4295

>NTDB_id=656501 MIH18_RS07660 WP_283164857.1 1659035..1659469(+) (pilA2) [Marinobacter sp. M3C]
MKKVQQGFTLIELMIVVAIIGILAAIAIPAYQDYTIRAKVSEVLVIASAARISVAEYYISTGDMPASTNQAGINDNADQS
DYVSGITFATSSAGAQLTYTLENLGGDADTTTFIYQVVGSANGVNVTCTGGTLPGKYRPANCRL

Nucleotide

• Length: 435 bp

>NTDB_id=656501 MIH18_RS07660 WP_283164857.1 1659035..1659469(+) (pilA2) [Marinobacter sp. M3C]
ATGAAAAAAGTTCAACAGGGTTTTACACTGATCGAGCTGATGATCGTTGTTGCGATTATTGGTATTCTGGCAGCCATCGC
AATTCCGGCGTATCAGGATTACACCATCCGCGCCAAGGTCAGTGAAGTTTTGGTAATTGCCAGTGCTGCGCGCATCAGCG
TTGCTGAATATTATATCAGCACCGGCGATATGCCAGCATCCACAAACCAAGCGGGCATAAACGATAACGCCGACCAGAGC
GACTACGTTTCTGGTATTACGTTTGCTACCTCTAGCGCCGGTGCCCAGTTGACCTATACTCTGGAAAACCTCGGTGGCGA
TGCGGATACAACAACTTTCATTTATCAGGTTGTTGGCAGCGCCAACGGTGTAAACGTTACCTGCACAGGGGGCACCCTTC
CAGGCAAGTACCGCCCAGCTAACTGTCGCTTATAG

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-143)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	51.773	97.917	0.507
pilA2	Legionella pneumophila str. Paris	51.064	97.917	0.5
comP	Acinetobacter baylyi ADP1	41.497	100	0.424
pilE	Neisseria gonorrhoeae strain FA1090	37.975	100	0.417
pilA/pilAI	Pseudomonas stutzeri DSM 10701	39.041	100	0.396
pilA	Haemophilus influenzae 86-028NP	37.589	97.917	0.368