Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LOZ87_RS01990 Genome accession   NZ_CP087391
Coordinates   392971..393090 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain ZF57     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 387971..398090
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ87_RS01975 (LOZ87_01975) - 389583..390266 (+) 684 WP_007410267.1 response regulator transcription factor -
  LOZ87_RS01980 (LOZ87_01980) - 390253..391686 (+) 1434 WP_020953885.1 ATP-binding protein -
  LOZ87_RS01985 (LOZ87_01985) rapC 391839..392987 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  LOZ87_RS01990 (LOZ87_01990) phrC 392971..393090 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LOZ87_RS01995 (LOZ87_01995) - 393238..393348 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  LOZ87_RS02000 (LOZ87_02000) - 393428..394792 (-) 1365 WP_020955323.1 aspartate kinase -
  LOZ87_RS02005 (LOZ87_02005) ceuB 395206..396159 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  LOZ87_RS02010 (LOZ87_02010) - 396149..397096 (+) 948 WP_039062612.1 iron chelate uptake ABC transporter family permease subunit -
  LOZ87_RS02015 (LOZ87_02015) - 397090..397848 (+) 759 WP_039062614.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=629244 LOZ87_RS01990 WP_003156334.1 392971..393090(+) (phrC) [Bacillus amyloliquefaciens strain ZF57]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=629244 LOZ87_RS01990 WP_003156334.1 392971..393090(+) (phrC) [Bacillus amyloliquefaciens strain ZF57]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718