Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LK342_RS09615 | Genome accession | NZ_CP086574 |
| Coordinates | 2011409..2011879 (-) | Length | 156 a.a. |
| NCBI ID | WP_047437043.1 | Uniprot ID | - |
| Organism | Staphylococcus argenteus strain RIVM_M046968 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2010716..2061676 | 2011409..2011879 | within | 0 |
Gene organization within MGE regions
Location: 2010716..2061676
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LK342_RS09615 (LK342_09615) | ssbA | 2011409..2011879 (-) | 471 | WP_047437043.1 | single-stranded DNA-binding protein | Machinery gene |
| LK342_RS09620 (LK342_09620) | - | 2011880..2012497 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LK342_RS09625 (LK342_09625) | - | 2012578..2013498 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| LK342_RS09630 (LK342_09630) | - | 2013500..2015443 (-) | 1944 | WP_047437048.1 | AAA family ATPase | - |
| LK342_RS09635 (LK342_09635) | - | 2015452..2015715 (-) | 264 | WP_072292182.1 | hypothetical protein | - |
| LK342_RS09640 (LK342_09640) | - | 2015724..2015984 (-) | 261 | WP_047437050.1 | DUF1108 family protein | - |
| LK342_RS09645 (LK342_09645) | - | 2015989..2016291 (-) | 303 | WP_047437053.1 | DUF2482 family protein | - |
| LK342_RS09650 (LK342_09650) | - | 2016386..2016547 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| LK342_RS09655 (LK342_09655) | - | 2016544..2016864 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LK342_RS09660 (LK342_09660) | - | 2016924..2017298 (+) | 375 | WP_047437056.1 | hypothetical protein | - |
| LK342_RS09665 (LK342_09665) | - | 2017303..2017497 (-) | 195 | WP_047437059.1 | hypothetical protein | - |
| LK342_RS09670 (LK342_09670) | - | 2017754..2017936 (-) | 183 | WP_072292181.1 | hypothetical protein | - |
| LK342_RS09675 (LK342_09675) | - | 2018080..2018829 (-) | 750 | WP_047437065.1 | phage antirepressor KilAC domain-containing protein | - |
| LK342_RS09680 (LK342_09680) | - | 2018846..2019115 (-) | 270 | WP_047432554.1 | helix-turn-helix transcriptional regulator | - |
| LK342_RS09685 (LK342_09685) | - | 2019134..2019287 (-) | 154 | Protein_1875 | transcriptional regulator | - |
| LK342_RS09690 (LK342_09690) | - | 2019250..2019963 (+) | 714 | WP_031768797.1 | XRE family transcriptional regulator | - |
| LK342_RS09695 (LK342_09695) | - | 2019981..2020595 (+) | 615 | WP_047437068.1 | hypothetical protein | - |
| LK342_RS09700 (LK342_09700) | - | 2020790..2020957 (+) | 168 | WP_047437071.1 | hypothetical protein | - |
| LK342_RS09705 (LK342_09705) | - | 2021237..2022328 (+) | 1092 | WP_230582822.1 | Abi family protein | - |
| LK342_RS09710 (LK342_09710) | - | 2022388..2023425 (+) | 1038 | WP_000857198.1 | site-specific integrase | - |
| LK342_RS09715 (LK342_09715) | sph | 2023476..2024306 (+) | 831 | Protein_1881 | sphingomyelin phosphodiesterase | - |
| LK342_RS09720 (LK342_09720) | - | 2024930..2025946 (-) | 1017 | WP_047528390.1 | leukocidin/hemolysin toxin family protein | - |
| LK342_RS09725 (LK342_09725) | - | 2025968..2027023 (-) | 1056 | WP_047528391.1 | leukocidin/hemolysin toxin family protein | - |
| LK342_RS09730 (LK342_09730) | - | 2027450..2028673 (+) | 1224 | WP_047528392.1 | ArgE/DapE family deacylase | - |
| LK342_RS09735 (LK342_09735) | - | 2029281..2030588 (+) | 1308 | WP_047528393.1 | TrkH family potassium uptake protein | - |
| LK342_RS09740 (LK342_09740) | groL | 2031180..2032796 (-) | 1617 | WP_001118817.1 | chaperonin GroEL | - |
| LK342_RS09745 (LK342_09745) | groES | 2032872..2033156 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| LK342_RS09750 (LK342_09750) | mroQ | 2033333..2034076 (+) | 744 | WP_047528396.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| LK342_RS09755 (LK342_09755) | - | 2034102..2035361 (-) | 1260 | WP_047528397.1 | SdrH family protein | - |
| LK342_RS09760 (LK342_09760) | - | 2035557..2036183 (+) | 627 | WP_047437110.1 | nitroreductase family protein | - |
| LK342_RS09765 (LK342_09765) | - | 2036284..2037069 (+) | 786 | WP_047528398.1 | carbon-nitrogen family hydrolase | - |
| LK342_RS13405 (LK342_09770) | - | 2037589..2037723 (-) | 135 | WP_001823225.1 | delta-lysin family phenol-soluble modulin | - |
| LK342_RS09775 (LK342_09775) | - | 2037959..2038522 (+) | 564 | WP_047437114.1 | accessory gene regulator AgrB | - |
| LK342_RS09780 (LK342_09780) | - | 2038526..2038666 (+) | 141 | WP_047437117.1 | cyclic lactone autoinducer peptide | - |
| LK342_RS09785 (LK342_09785) | - | 2038691..2039983 (+) | 1293 | WP_047528400.1 | GHKL domain-containing protein | - |
| LK342_RS09790 (LK342_09790) | agrA | 2040002..2040718 (+) | 717 | WP_000688486.1 | LytTR family DNA-binding domain-containing protein | Regulator |
| LK342_RS09795 (LK342_09795) | - | 2041071..2042030 (-) | 960 | WP_047528401.1 | carbohydrate kinase | - |
| LK342_RS09800 (LK342_09800) | - | 2042027..2043511 (-) | 1485 | WP_000141408.1 | sucrose-6-phosphate hydrolase | - |
| LK342_RS09805 (LK342_09805) | - | 2043660..2044610 (-) | 951 | WP_047528402.1 | LacI family DNA-binding transcriptional regulator | - |
| LK342_RS09810 (LK342_09810) | - | 2044782..2046032 (-) | 1251 | WP_001052255.1 | ammonium transporter | - |
| LK342_RS09815 (LK342_09815) | - | 2046247..2046471 (-) | 225 | WP_047528404.1 | sulfurtransferase TusA family protein | - |
| LK342_RS09820 (LK342_09820) | - | 2046546..2047628 (-) | 1083 | WP_047528406.1 | YeeE/YedE family protein | - |
| LK342_RS09825 (LK342_09825) | - | 2047927..2048562 (-) | 636 | WP_001283609.1 | redox-sensing transcriptional repressor Rex | - |
| LK342_RS09830 (LK342_09830) | - | 2048816..2050744 (+) | 1929 | WP_047528407.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LK342_RS09835 (LK342_09835) | - | 2051106..2052716 (+) | 1611 | WP_250340822.1 | MutS family DNA mismatch repair protein | - |
| LK342_RS09840 (LK342_09840) | tsaD | 2052817..2053842 (-) | 1026 | WP_031787868.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD | - |
| LK342_RS09845 (LK342_09845) | rimI | 2053835..2054299 (-) | 465 | WP_000372752.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
| LK342_RS09850 (LK342_09850) | tsaB | 2054272..2054934 (-) | 663 | WP_047432522.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| LK342_RS09855 (LK342_09855) | tsaE | 2054915..2055376 (-) | 462 | WP_031787870.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| LK342_RS09860 (LK342_09860) | - | 2055413..2055562 (+) | 150 | WP_031787871.1 | hypothetical protein | - |
| LK342_RS09865 (LK342_09865) | ilvD | 2055894..2057582 (+) | 1689 | WP_001255776.1 | dihydroxy-acid dehydratase | - |
| LK342_RS09870 (LK342_09870) | ilvB | 2057600..2059369 (+) | 1770 | WP_014373872.1 | biosynthetic-type acetolactate synthase large subunit | - |
| LK342_RS09875 (LK342_09875) | - | 2059369..2059623 (+) | 255 | WP_000196758.1 | ACT domain-containing protein | - |
| LK342_RS09880 (LK342_09880) | ilvC | 2059762..2060766 (+) | 1005 | WP_000214558.1 | ketol-acid reductoisomerase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17693.65 Da Isoelectric Point: 8.3520
>NTDB_id=625598 LK342_RS09615 WP_047437043.1 2011409..2011879(-) (ssbA) [Staphylococcus argenteus strain RIVM_M046968]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVAHSIQFLEPKNTNDNQQDLYQKQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVAHSIQFLEPKNTNDNQQDLYQKQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=625598 LK342_RS09615 WP_047437043.1 2011409..2011879(-) (ssbA) [Staphylococcus argenteus strain RIVM_M046968]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCGCAAGGAGAACGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCCATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAAAAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCGCAAGGAGAACGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCCATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAAAAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |
| ssb | Neisseria meningitidis MC58 |
34.104 |
100 |
0.378 |
| ssb | Neisseria gonorrhoeae MS11 |
34.104 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.844 |
100 |
0.365 |