Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LL668_RS13970 | Genome accession | NZ_CP086257 |
| Coordinates | 3055898..3056359 (+) | Length | 153 a.a. |
| NCBI ID | WP_228367143.1 | Uniprot ID | - |
| Organism | Providencia rettgeri strain KM4 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3007669..3060373 | 3055898..3056359 | within | 0 |
Gene organization within MGE regions
Location: 3007669..3060373
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL668_RS13655 (LL668_13675) | - | 3007669..3009096 (-) | 1428 | WP_228367088.1 | hypothetical protein | - |
| LL668_RS13660 (LL668_13680) | - | 3009170..3010180 (-) | 1011 | WP_228367089.1 | DUF6453 family protein | - |
| LL668_RS21320 (LL668_13685) | - | 3010177..3013350 (-) | 3174 | WP_228367090.1 | phage tail tip fiber protein | - |
| LL668_RS13670 (LL668_13690) | - | 3013351..3013749 (-) | 399 | WP_228367091.1 | DUF6950 family protein | - |
| LL668_RS13675 (LL668_13695) | - | 3013807..3014466 (-) | 660 | WP_228367092.1 | hypothetical protein | - |
| LL668_RS13680 (LL668_13700) | - | 3014515..3015099 (-) | 585 | WP_228367093.1 | hypothetical protein | - |
| LL668_RS13685 (LL668_13705) | - | 3015099..3015695 (-) | 597 | WP_228367094.1 | hypothetical protein | - |
| LL668_RS13690 (LL668_13710) | - | 3015699..3019130 (-) | 3432 | WP_228367095.1 | phage tail tape measure protein | - |
| LL668_RS13695 (LL668_13715) | - | 3019214..3019720 (-) | 507 | WP_228367096.1 | hypothetical protein | - |
| LL668_RS13700 (LL668_13720) | - | 3019817..3020557 (-) | 741 | WP_228367097.1 | GTP pyrophosphokinase | - |
| LL668_RS13705 (LL668_13725) | - | 3020690..3020902 (-) | 213 | WP_228367098.1 | hypothetical protein | - |
| LL668_RS13710 (LL668_13730) | - | 3021083..3021427 (+) | 345 | WP_228367099.1 | two pore domain potassium channel family protein | - |
| LL668_RS13715 (LL668_13735) | umuC | 3021508..3022773 (-) | 1266 | WP_228367100.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
| LL668_RS13720 (LL668_13740) | umuD | 3022773..3023186 (-) | 414 | WP_228367101.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| LL668_RS13725 (LL668_13745) | - | 3023461..3023985 (-) | 525 | WP_228367102.1 | Dps family protein | - |
| LL668_RS21325 (LL668_13750) | - | 3024406..3024651 (-) | 246 | WP_228367103.1 | hypothetical protein | - |
| LL668_RS13735 (LL668_13755) | - | 3024735..3025169 (-) | 435 | WP_228367104.1 | hypothetical protein | - |
| LL668_RS13740 (LL668_13760) | - | 3025222..3026154 (-) | 933 | WP_228367105.1 | phage tail tube protein | - |
| LL668_RS13745 (LL668_13765) | - | 3026163..3026558 (-) | 396 | WP_228367106.1 | phage tail terminator-like protein | - |
| LL668_RS13750 (LL668_13770) | - | 3026555..3026968 (-) | 414 | WP_228367107.1 | HK97 gp10 family phage protein | - |
| LL668_RS13755 (LL668_13775) | - | 3026970..3027359 (-) | 390 | WP_419181773.1 | glutamate 5-kinase | - |
| LL668_RS13760 (LL668_13780) | - | 3027359..3027751 (-) | 393 | WP_228367108.1 | protein singed | - |
| LL668_RS13765 (LL668_13785) | - | 3027761..3027931 (-) | 171 | WP_198633478.1 | hypothetical protein | - |
| LL668_RS13770 (LL668_13790) | - | 3027975..3029108 (-) | 1134 | WP_228367109.1 | P22 phage major capsid protein family protein | - |
| LL668_RS13775 (LL668_13795) | - | 3029199..3029963 (-) | 765 | WP_228367110.1 | DUF6651 domain-containing protein | - |
| LL668_RS13780 (LL668_13800) | - | 3030080..3031192 (-) | 1113 | WP_228367111.1 | phage minor head protein | - |
| LL668_RS13785 (LL668_13805) | - | 3031196..3032581 (-) | 1386 | WP_228367112.1 | DUF4055 domain-containing protein | - |
| LL668_RS13790 (LL668_13810) | - | 3032585..3034072 (-) | 1488 | WP_228367113.1 | terminase | - |
| LL668_RS13795 (LL668_13815) | - | 3034082..3034618 (-) | 537 | WP_228367114.1 | terminase small subunit | - |
| LL668_RS13800 (LL668_13820) | - | 3034702..3035271 (+) | 570 | WP_228367115.1 | hypothetical protein | - |
| LL668_RS13805 (LL668_13825) | - | 3035708..3036190 (-) | 483 | WP_228367116.1 | lipocalin family protein | - |
| LL668_RS21495 | lysC | 3038268..3038513 (-) | 246 | WP_419181784.1 | Rz1-like lysis system protein LysC | - |
| LL668_RS13810 (LL668_13830) | - | 3038419..3038799 (-) | 381 | WP_228367117.1 | hypothetical protein | - |
| LL668_RS13815 (LL668_13835) | - | 3038858..3039427 (-) | 570 | WP_282564789.1 | lysozyme | - |
| LL668_RS13820 (LL668_13840) | - | 3039408..3039608 (-) | 201 | WP_198634808.1 | phage holin family protein | - |
| LL668_RS13825 (LL668_13845) | - | 3040271..3040690 (-) | 420 | WP_228367118.1 | hypothetical protein | - |
| LL668_RS13830 (LL668_13850) | - | 3041500..3041697 (-) | 198 | WP_228367119.1 | hypothetical protein | - |
| LL668_RS13835 (LL668_13855) | nqrE | 3041790..3042389 (+) | 600 | WP_228367120.1 | NADH:ubiquinone reductase (Na(+)-transporting) subunit E | - |
| LL668_RS13840 (LL668_13860) | - | 3042601..3043734 (-) | 1134 | WP_228367121.1 | HNH endonuclease signature motif containing protein | - |
| LL668_RS21330 (LL668_13865) | - | 3043731..3043934 (-) | 204 | WP_187550043.1 | hypothetical protein | - |
| LL668_RS13850 (LL668_13870) | - | 3043934..3044551 (-) | 618 | WP_228367122.1 | recombination protein NinG | - |
| LL668_RS13855 (LL668_13875) | - | 3044627..3045001 (-) | 375 | WP_228367123.1 | hypothetical protein | - |
| LL668_RS13860 (LL668_13880) | - | 3045105..3045305 (-) | 201 | WP_228367124.1 | hypothetical protein | - |
| LL668_RS13865 (LL668_13885) | - | 3045316..3045762 (-) | 447 | WP_228367125.1 | DUF1367 family protein | - |
| LL668_RS13870 (LL668_13890) | - | 3045822..3046121 (+) | 300 | WP_228367126.1 | hypothetical protein | - |
| LL668_RS21500 (LL668_13895) | - | 3046134..3046316 (-) | 183 | WP_419181774.1 | Lar family restriction alleviation protein | - |
| LL668_RS13875 (LL668_13900) | - | 3046313..3046540 (-) | 228 | WP_228367127.1 | hypothetical protein | - |
| LL668_RS21335 (LL668_13905) | - | 3046537..3046740 (-) | 204 | WP_228367128.1 | hypothetical protein | - |
| LL668_RS13885 (LL668_13910) | - | 3046739..3047413 (+) | 675 | WP_228367129.1 | DUF4145 domain-containing protein | - |
| LL668_RS13890 (LL668_13915) | - | 3047493..3048134 (-) | 642 | WP_110732175.1 | hypothetical protein | - |
| LL668_RS21340 (LL668_13920) | - | 3048135..3048317 (-) | 183 | WP_228367130.1 | hypothetical protein | - |
| LL668_RS13900 (LL668_13925) | - | 3048324..3048998 (-) | 675 | WP_228367131.1 | replication protein P | - |
| LL668_RS13905 (LL668_13930) | - | 3048995..3049924 (-) | 930 | WP_228367132.1 | replication protein | - |
| LL668_RS13910 (LL668_13935) | - | 3050047..3050295 (-) | 249 | WP_228367133.1 | hypothetical protein | - |
| LL668_RS13915 (LL668_13940) | - | 3050295..3050615 (-) | 321 | WP_228367134.1 | CII family transcriptional regulator | - |
| LL668_RS13920 (LL668_13945) | - | 3050716..3050919 (-) | 204 | WP_228367135.1 | helix-turn-helix transcriptional regulator | - |
| LL668_RS13925 (LL668_13950) | - | 3051025..3051657 (+) | 633 | WP_228367136.1 | LexA family protein | - |
| LL668_RS13930 (LL668_13955) | - | 3051995..3052309 (+) | 315 | WP_228367137.1 | hypothetical protein | - |
| LL668_RS21080 | - | 3052324..3052455 (+) | 132 | WP_267081375.1 | hypothetical protein | - |
| LL668_RS13935 (LL668_13960) | - | 3052895..3053134 (+) | 240 | WP_228367138.1 | hypothetical protein | - |
| LL668_RS21345 (LL668_13965) | - | 3053164..3053346 (+) | 183 | WP_228367139.1 | hypothetical protein | - |
| LL668_RS13945 (LL668_13970) | - | 3053348..3053680 (+) | 333 | WP_228367140.1 | hypothetical protein | - |
| LL668_RS21350 (LL668_13975) | - | 3053902..3054078 (+) | 177 | WP_167363358.1 | hypothetical protein | - |
| LL668_RS13955 (LL668_13980) | - | 3054088..3054294 (+) | 207 | WP_228367141.1 | hypothetical protein | - |
| LL668_RS13960 (LL668_13985) | - | 3054291..3055109 (+) | 819 | WP_228367142.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| LL668_RS13965 (LL668_13990) | recT | 3055102..3055905 (+) | 804 | WP_131681033.1 | recombination protein RecT | - |
| LL668_RS13970 (LL668_13995) | ssb | 3055898..3056359 (+) | 462 | WP_228367143.1 | single-stranded DNA-binding protein | Machinery gene |
| LL668_RS13975 (LL668_14000) | - | 3056455..3057375 (+) | 921 | WP_228367144.1 | DNA cytosine methyltransferase | - |
| LL668_RS21355 (LL668_14005) | - | 3059327..3060373 (+) | 1047 | WP_228367145.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16956.80 Da Isoelectric Point: 5.8961
>NTDB_id=624081 LL668_RS13970 WP_228367143.1 3055898..3056359(+) (ssb) [Providencia rettgeri strain KM4]
MASRGVNKVILVGNLGQDVEMRYMPNGGAVANLTLATSESWRDKQSGEMREKTEWHRVCIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGNGNSNNNGNQTGNKSTSSPNQQYSNQTKPPMDFDDDIPF
MASRGVNKVILVGNLGQDVEMRYMPNGGAVANLTLATSESWRDKQSGEMREKTEWHRVCIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGNGNSNNNGNQTGNKSTSSPNQQYSNQTKPPMDFDDDIPF
Nucleotide
Download Length: 462 bp
>NTDB_id=624081 LL668_RS13970 WP_228367143.1 3055898..3056359(+) (ssb) [Providencia rettgeri strain KM4]
ATGGCTAGTCGCGGAGTGAATAAGGTCATACTTGTTGGAAATTTGGGTCAAGATGTCGAAATGCGCTACATGCCTAACGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAGCAATCAGGTGAAATGCGCGAGAAAACTG
AATGGCATCGAGTGTGCATCTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATATCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTCTGCAAACCCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTGGTAGTAAATATCGG
CGGTACGATGCAAATGCTAGGAAATGGCAATAGCAATAACAACGGCAATCAAACAGGAAATAAGAGTACATCCTCCCCAA
ATCAACAATATAGTAACCAAACTAAACCTCCTATGGATTTTGATGATGACATTCCATTCTAA
ATGGCTAGTCGCGGAGTGAATAAGGTCATACTTGTTGGAAATTTGGGTCAAGATGTCGAAATGCGCTACATGCCTAACGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAGCAATCAGGTGAAATGCGCGAGAAAACTG
AATGGCATCGAGTGTGCATCTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATATCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTCTGCAAACCCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTGGTAGTAAATATCGG
CGGTACGATGCAAATGCTAGGAAATGGCAATAGCAATAACAACGGCAATCAAACAGGAAATAAGAGTACATCCTCCCCAA
ATCAACAATATAGTAACCAAACTAAACCTCCTATGGATTTTGATGATGACATTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
62.921 |
100 |
0.732 |
| ssb | Glaesserella parasuis strain SC1401 |
52.198 |
100 |
0.621 |
| ssb | Neisseria meningitidis MC58 |
40.909 |
100 |
0.471 |
| ssb | Neisseria gonorrhoeae MS11 |
40.341 |
100 |
0.464 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
33.333 |
100 |
0.386 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
32.558 |
100 |
0.366 |