Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LI911_RS13870 | Genome accession | NZ_CP085318 |
| Coordinates | 2791294..2791764 (+) | Length | 156 a.a. |
| NCBI ID | WP_031897016.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CKFA-361 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2772632..2799005 | 2791294..2791764 | within | 0 |
Gene organization within MGE regions
Location: 2772632..2799005
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LI911_RS13755 | - | 2772632..2773075 (+) | 444 | WP_000361985.1 | hypothetical protein | - |
| LI911_RS13760 | - | 2773798..2775021 (-) | 1224 | WP_000206642.1 | ArgE/DapE family deacylase | - |
| LI911_RS13765 | lukH | 2775457..2776512 (+) | 1056 | WP_000791418.1 | bi-component leukocidin LukGH subunit H | - |
| LI911_RS13770 | lukG | 2776534..2777550 (+) | 1017 | WP_000595393.1 | bi-component leukocidin LukGH subunit G | - |
| LI911_RS13775 | sph | 2777788..2778612 (-) | 825 | Protein_2670 | sphingomyelin phosphodiesterase | - |
| LI911_RS13780 | - | 2778669..2779706 (-) | 1038 | WP_323147750.1 | tyrosine-type recombinase/integrase | - |
| LI911_RS13785 | - | 2779760..2780773 (-) | 1014 | WP_031826883.1 | restriction endonuclease subunit S | - |
| LI911_RS13790 | - | 2780754..2782664 (-) | 1911 | WP_031826882.1 | HsdM family class I SAM-dependent methyltransferase | - |
| LI911_RS13795 | - | 2782760..2783491 (-) | 732 | WP_419790158.1 | S24 family peptidase | - |
| LI911_RS13800 | - | 2783643..2783855 (+) | 213 | WP_000213811.1 | helix-turn-helix transcriptional regulator | - |
| LI911_RS13805 | - | 2783903..2784163 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| LI911_RS13810 | - | 2784187..2784726 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| LI911_RS13815 | - | 2784783..2785528 (+) | 746 | Protein_2678 | phage antirepressor KilAC domain-containing protein | - |
| LI911_RS13820 | - | 2785544..2785741 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| LI911_RS13825 | - | 2785772..2785912 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| LI911_RS13830 | - | 2785927..2786559 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| LI911_RS13835 | - | 2786618..2786938 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LI911_RS13840 | - | 2786935..2787096 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LI911_RS13845 | - | 2787189..2787449 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| LI911_RS13850 | - | 2787458..2787721 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LI911_RS13855 | - | 2787718..2789673 (+) | 1956 | WP_047211354.1 | AAA family ATPase | - |
| LI911_RS13860 | - | 2789675..2790595 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| LI911_RS13865 | - | 2790676..2791293 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LI911_RS13870 | ssbA | 2791294..2791764 (+) | 471 | WP_031897016.1 | single-stranded DNA-binding protein | Machinery gene |
| LI911_RS13875 | - | 2791794..2792678 (+) | 885 | WP_000148311.1 | DnaD domain protein | - |
| LI911_RS13880 | - | 2792685..2792903 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LI911_RS13885 | - | 2792912..2793316 (+) | 405 | WP_000401971.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LI911_RS13890 | - | 2793329..2793697 (+) | 369 | WP_031887145.1 | SA1788 family PVL leukocidin-associated protein | - |
| LI911_RS13895 | - | 2793701..2793943 (+) | 243 | WP_031887144.1 | SAV1978 family virulence-associated passenger protein | - |
| LI911_RS13900 | - | 2793957..2794388 (+) | 432 | WP_031887143.1 | hypothetical protein | - |
| LI911_RS13905 | - | 2794385..2794894 (+) | 510 | WP_072472703.1 | hypothetical protein | - |
| LI911_RS13910 | - | 2794891..2795301 (+) | 411 | WP_072472704.1 | acetyltransferase | - |
| LI911_RS13915 | - | 2795294..2795545 (+) | 252 | WP_001836226.1 | DUF1024 family protein | - |
| LI911_RS13920 | - | 2795535..2795717 (+) | 183 | WP_000028421.1 | hypothetical protein | - |
| LI911_RS13925 | - | 2795710..2796219 (+) | 510 | WP_031866561.1 | dUTP diphosphatase | - |
| LI911_RS13930 | - | 2796256..2796408 (+) | 153 | WP_031768020.1 | DUF1381 domain-containing protein | - |
| LI911_RS13935 | - | 2796401..2796859 (+) | 459 | WP_031768021.1 | hypothetical protein | - |
| LI911_RS13940 | rinB | 2796872..2797021 (+) | 150 | WP_070030217.1 | transcriptional activator RinB | - |
| LI911_RS13945 | - | 2797180..2797830 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| LI911_RS13950 | - | 2797830..2798030 (+) | 201 | WP_031929213.1 | DUF1514 family protein | - |
| LI911_RS13955 | - | 2798058..2798474 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LI911_RS13960 | - | 2798706..2799005 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17730.57 Da Isoelectric Point: 4.7821
>NTDB_id=617174 LI911_RS13870 WP_031897016.1 2791294..2791764(+) (ssbA) [Staphylococcus aureus strain CKFA-361]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=617174 LI911_RS13870 WP_031897016.1 2791294..2791764(+) (ssbA) [Staphylococcus aureus strain CKFA-361]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |