Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LAU42_RS07275 | Genome accession | NZ_CP083608 |
| Coordinates | 1390887..1391342 (-) | Length | 151 a.a. |
| NCBI ID | WP_224182966.1 | Uniprot ID | - |
| Organism | Macrococcus armenti strain JEK37 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1362216..1400471 | 1390887..1391342 | within | 0 |
Gene organization within MGE regions
Location: 1362216..1400471
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAU42_RS07055 (LAU42_07055) | - | 1362216..1362947 (+) | 732 | WP_224182923.1 | NAD-dependent protein deacylase | - |
| LAU42_RS07060 (LAU42_07060) | - | 1363209..1363394 (-) | 186 | WP_224182924.1 | helix-turn-helix domain-containing protein | - |
| LAU42_RS07065 (LAU42_07065) | - | 1363819..1364616 (-) | 798 | WP_224182925.1 | SH3 domain-containing protein | - |
| LAU42_RS07070 (LAU42_07070) | - | 1364621..1364869 (-) | 249 | WP_224182926.1 | phage holin | - |
| LAU42_RS07075 (LAU42_07075) | - | 1364921..1365304 (-) | 384 | WP_224182927.1 | hypothetical protein | - |
| LAU42_RS07080 (LAU42_07080) | - | 1365722..1366036 (-) | 315 | WP_224182928.1 | hypothetical protein | - |
| LAU42_RS07085 (LAU42_07085) | - | 1366029..1367915 (-) | 1887 | WP_224182929.1 | phage tail protein | - |
| LAU42_RS07090 (LAU42_07090) | - | 1367925..1369673 (-) | 1749 | WP_224182930.1 | glycoside hydrolase family 55 protein | - |
| LAU42_RS07095 (LAU42_07095) | - | 1369689..1370543 (-) | 855 | WP_224182931.1 | phage tail domain-containing protein | - |
| LAU42_RS07100 (LAU42_07100) | - | 1370561..1374718 (-) | 4158 | WP_224182932.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| LAU42_RS07105 (LAU42_07105) | gpGT | 1374757..1374906 (-) | 150 | WP_224182933.1 | phage tail assembly chaperone GT | - |
| LAU42_RS07110 (LAU42_07110) | gpG | 1374939..1375277 (-) | 339 | WP_224182934.1 | phage tail assembly chaperone G | - |
| LAU42_RS07115 (LAU42_07115) | - | 1375303..1375497 (-) | 195 | WP_224182935.1 | hypothetical protein | - |
| LAU42_RS07120 (LAU42_07120) | - | 1375573..1376187 (-) | 615 | WP_224182936.1 | major tail protein | - |
| LAU42_RS07125 (LAU42_07125) | - | 1376201..1376617 (-) | 417 | WP_224182937.1 | hypothetical protein | - |
| LAU42_RS07130 (LAU42_07130) | - | 1376614..1377009 (-) | 396 | WP_224182938.1 | hypothetical protein | - |
| LAU42_RS07135 (LAU42_07135) | - | 1376999..1377376 (-) | 378 | WP_224182939.1 | hypothetical protein | - |
| LAU42_RS07140 (LAU42_07140) | - | 1377330..1377644 (-) | 315 | WP_224182940.1 | phage gp6-like head-tail connector protein | - |
| LAU42_RS07145 (LAU42_07145) | - | 1377653..1377814 (-) | 162 | WP_224182941.1 | hypothetical protein | - |
| LAU42_RS07150 (LAU42_07150) | - | 1377858..1379072 (-) | 1215 | WP_224182942.1 | phage major capsid protein | - |
| LAU42_RS07155 (LAU42_07155) | - | 1379084..1379872 (-) | 789 | WP_224182943.1 | head maturation protease, ClpP-related | - |
| LAU42_RS07160 (LAU42_07160) | - | 1379869..1381011 (-) | 1143 | WP_224182944.1 | phage portal protein | - |
| LAU42_RS07165 (LAU42_07165) | - | 1381022..1382680 (-) | 1659 | WP_224182945.1 | terminase large subunit | - |
| LAU42_RS07170 (LAU42_07170) | - | 1382677..1383021 (-) | 345 | WP_133433636.1 | hypothetical protein | - |
| LAU42_RS07175 (LAU42_07175) | - | 1383201..1383518 (-) | 318 | WP_224182946.1 | HNH endonuclease | - |
| LAU42_RS07180 (LAU42_07180) | - | 1383699..1384136 (-) | 438 | WP_224182947.1 | transcriptional regulator | - |
| LAU42_RS07185 (LAU42_07185) | - | 1384189..1384488 (-) | 300 | WP_224182948.1 | MazG-like family protein | - |
| LAU42_RS07190 (LAU42_07190) | - | 1384481..1384684 (-) | 204 | WP_224182949.1 | hypothetical protein | - |
| LAU42_RS07195 (LAU42_07195) | - | 1384688..1384945 (-) | 258 | WP_224182950.1 | hypothetical protein | - |
| LAU42_RS07200 (LAU42_07200) | - | 1384929..1385276 (-) | 348 | WP_224182951.1 | hypothetical protein | - |
| LAU42_RS07205 (LAU42_07205) | - | 1385269..1385673 (-) | 405 | WP_224182952.1 | hypothetical protein | - |
| LAU42_RS07210 (LAU42_07210) | - | 1385796..1385966 (-) | 171 | WP_224182953.1 | hypothetical protein | - |
| LAU42_RS07215 (LAU42_07215) | - | 1385990..1386238 (-) | 249 | WP_224182954.1 | hypothetical protein | - |
| LAU42_RS07220 (LAU42_07220) | - | 1386446..1386715 (-) | 270 | WP_224182955.1 | hypothetical protein | - |
| LAU42_RS07225 (LAU42_07225) | - | 1386779..1387003 (-) | 225 | WP_224182956.1 | hypothetical protein | - |
| LAU42_RS07230 (LAU42_07230) | - | 1387013..1387240 (-) | 228 | WP_224182957.1 | hypothetical protein | - |
| LAU42_RS07235 (LAU42_07235) | - | 1387252..1387476 (-) | 225 | WP_224182958.1 | hypothetical protein | - |
| LAU42_RS07240 (LAU42_07240) | - | 1387489..1388241 (-) | 753 | WP_224182959.1 | ParB N-terminal domain-containing protein | - |
| LAU42_RS07245 (LAU42_07245) | - | 1388256..1388438 (-) | 183 | WP_224182960.1 | hypothetical protein | - |
| LAU42_RS07250 (LAU42_07250) | - | 1388451..1388876 (-) | 426 | WP_224182961.1 | hypothetical protein | - |
| LAU42_RS07255 (LAU42_07255) | - | 1388883..1389284 (-) | 402 | WP_224182962.1 | DUF1064 domain-containing protein | - |
| LAU42_RS07260 (LAU42_07260) | - | 1389309..1389884 (-) | 576 | WP_224182963.1 | NUMOD4 motif-containing HNH endonuclease | - |
| LAU42_RS07265 (LAU42_07265) | - | 1389884..1390534 (-) | 651 | WP_224182964.1 | putative HNHc nuclease | - |
| LAU42_RS07270 (LAU42_07270) | - | 1390537..1390866 (-) | 330 | WP_224182965.1 | hypothetical protein | - |
| LAU42_RS07275 (LAU42_07275) | ssbA | 1390887..1391342 (-) | 456 | WP_224182966.1 | single-stranded DNA-binding protein | Machinery gene |
| LAU42_RS07280 (LAU42_07280) | - | 1391332..1391544 (-) | 213 | WP_224182967.1 | hypothetical protein | - |
| LAU42_RS07285 (LAU42_07285) | - | 1391544..1392791 (-) | 1248 | WP_224182968.1 | replicative DNA helicase | - |
| LAU42_RS07290 (LAU42_07290) | - | 1392784..1393119 (-) | 336 | WP_224182969.1 | replicative helicase loader/inhibitor | - |
| LAU42_RS07295 (LAU42_07295) | - | 1393120..1393830 (-) | 711 | WP_224182970.1 | conserved phage C-terminal domain-containing protein | - |
| LAU42_RS07300 (LAU42_07300) | - | 1393835..1394455 (-) | 621 | WP_224182971.1 | DUF1071 domain-containing protein | - |
| LAU42_RS07305 (LAU42_07305) | - | 1394455..1394949 (-) | 495 | WP_224182972.1 | siphovirus Gp157 family protein | - |
| LAU42_RS07310 (LAU42_07310) | - | 1394942..1395208 (-) | 267 | WP_224182973.1 | hypothetical protein | - |
| LAU42_RS07315 (LAU42_07315) | - | 1395471..1395644 (-) | 174 | WP_224182974.1 | hypothetical protein | - |
| LAU42_RS07320 (LAU42_07320) | - | 1395625..1395792 (-) | 168 | WP_224182975.1 | hypothetical protein | - |
| LAU42_RS07325 (LAU42_07325) | - | 1395789..1396073 (-) | 285 | WP_224182976.1 | hypothetical protein | - |
| LAU42_RS07330 (LAU42_07330) | - | 1396101..1396886 (-) | 786 | WP_224182977.1 | BRO-N domain-containing protein | - |
| LAU42_RS07335 (LAU42_07335) | - | 1396902..1397132 (-) | 231 | WP_224182978.1 | helix-turn-helix transcriptional regulator | - |
| LAU42_RS07340 (LAU42_07340) | - | 1397286..1397927 (+) | 642 | WP_086042890.1 | XRE family transcriptional regulator | - |
| LAU42_RS07345 (LAU42_07345) | - | 1397990..1398520 (+) | 531 | WP_224182979.1 | Ltp family lipoprotein | - |
| LAU42_RS07350 (LAU42_07350) | - | 1398593..1399639 (+) | 1047 | WP_224182980.1 | site-specific integrase | - |
| LAU42_RS07360 (LAU42_07360) | - | 1399971..1400471 (-) | 501 | WP_224182981.1 | metallophosphoesterase family protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16631.45 Da Isoelectric Point: 6.3635
>NTDB_id=606582 LAU42_RS07275 WP_224182966.1 1390887..1391342(-) (ssbA) [Macrococcus armenti strain JEK37]
MLNRTILVGRMTKDPEMRVTPSGVTVTTFTLAVNRTFKNANGETEADFINIVTFRKTAENVNTFCSKGSLVGVDGRIQSR
SYDNQEGRRVYVTEVVADSVQFLETRGKNENAQQKTTQQKNAAAPPQNANNNNPFANATGPIDISDDDLPF
MLNRTILVGRMTKDPEMRVTPSGVTVTTFTLAVNRTFKNANGETEADFINIVTFRKTAENVNTFCSKGSLVGVDGRIQSR
SYDNQEGRRVYVTEVVADSVQFLETRGKNENAQQKTTQQKNAAAPPQNANNNNPFANATGPIDISDDDLPF
Nucleotide
Download Length: 456 bp
>NTDB_id=606582 LAU42_RS07275 WP_224182966.1 1390887..1391342(-) (ssbA) [Macrococcus armenti strain JEK37]
ATGTTAAATAGAACAATTTTAGTAGGACGCATGACCAAAGACCCAGAAATGAGAGTGACACCAAGTGGAGTGACTGTAAC
GACTTTCACATTAGCAGTAAATAGAACATTTAAGAACGCTAACGGAGAAACAGAAGCCGATTTTATTAATATCGTGACGT
TCAGAAAGACAGCTGAAAACGTCAATACTTTTTGTAGTAAAGGCTCATTAGTAGGAGTAGACGGACGTATTCAGTCACGC
AGTTATGATAATCAAGAAGGACGCAGAGTATACGTAACAGAAGTAGTAGCAGATAGTGTTCAATTCCTAGAAACGAGAGG
GAAGAACGAGAACGCTCAACAGAAAACGACACAACAAAAAAATGCAGCAGCGCCTCCTCAAAATGCGAATAATAACAATC
CGTTTGCGAACGCTACAGGACCAATAGATATCAGCGATGATGATTTACCATTCTAA
ATGTTAAATAGAACAATTTTAGTAGGACGCATGACCAAAGACCCAGAAATGAGAGTGACACCAAGTGGAGTGACTGTAAC
GACTTTCACATTAGCAGTAAATAGAACATTTAAGAACGCTAACGGAGAAACAGAAGCCGATTTTATTAATATCGTGACGT
TCAGAAAGACAGCTGAAAACGTCAATACTTTTTGTAGTAAAGGCTCATTAGTAGGAGTAGACGGACGTATTCAGTCACGC
AGTTATGATAATCAAGAAGGACGCAGAGTATACGTAACAGAAGTAGTAGCAGATAGTGTTCAATTCCTAGAAACGAGAGG
GAAGAACGAGAACGCTCAACAGAAAACGACACAACAAAAAAATGCAGCAGCGCCTCCTCAAAATGCGAATAATAACAATC
CGTTTGCGAACGCTACAGGACCAATAGATATCAGCGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.609 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.589 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.036 |
74.172 |
0.43 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.384 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.377 |
| ssbA | Streptococcus mutans UA159 |
37.086 |
100 |
0.371 |