Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JMO09_RS10180 Genome accession   NZ_CP080560
Coordinates   2059676..2060146 (-) Length   156 a.a.
NCBI ID   WP_000934768.1    Uniprot ID   -
Organism   Staphylococcus aureus strain HL17064     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2028218..2072719 2059676..2060146 within 0


Gene organization within MGE regions


Location: 2028218..2072719
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JMO09_RS09960 (JMO09_001992) - 2028218..2029663 (-) 1446 WP_069479479.1 SH3 domain-containing protein -
  JMO09_RS09965 (JMO09_001993) - 2029644..2030081 (-) 438 WP_000354133.1 phage holin -
  JMO09_RS09970 (JMO09_001994) - 2030137..2030532 (-) 396 WP_044435513.1 hypothetical protein -
  JMO09_RS09975 (JMO09_001995) - 2030538..2031710 (-) 1173 WP_044435510.1 BppU family phage baseplate upper protein -
  JMO09_RS09980 (JMO09_001996) - 2031723..2033492 (-) 1770 Protein_1976 glucosaminidase domain-containing protein -
  JMO09_RS09985 (JMO09_001997) - 2033603..2034223 (-) 621 WP_000355823.1 AP2 domain-containing protein -
  JMO09_RS15030 - 2034472..2034579 (-) 108 Protein_1978 hypothetical protein -
  JMO09_RS09990 (JMO09_001998) - 2034716..2035015 (-) 300 WP_176430632.1 DUF2951 domain-containing protein -
  JMO09_RS09995 (JMO09_001999) - 2035056..2035229 (-) 174 WP_001790193.1 XkdX family protein -
  JMO09_RS10000 (JMO09_002000) - 2035204..2035611 (-) 408 WP_044425645.1 DUF2977 domain-containing protein -
  JMO09_RS10005 (JMO09_002001) - 2035611..2037434 (-) 1824 WP_220374340.1 phage baseplate upper protein -
  JMO09_RS10010 (JMO09_002002) - 2037434..2039332 (-) 1899 WP_031874266.1 hypothetical protein -
  JMO09_RS10015 (JMO09_002003) - 2039345..2041231 (-) 1887 WP_001144709.1 SGNH/GDSL hydrolase family protein -
  JMO09_RS10020 (JMO09_002004) - 2041242..2042177 (-) 936 WP_000560196.1 phage tail domain-containing protein -
  JMO09_RS10025 (JMO09_002005) - 2042192..2045161 (-) 2970 WP_000414235.1 terminase -
  JMO09_RS10030 (JMO09_002006) - 2045164..2045505 (-) 342 WP_001580347.1 hypothetical protein -
  JMO09_RS10035 (JMO09_002007) - 2045526..2046020 (-) 495 WP_000141082.1 tail assembly chaperone -
  JMO09_RS10040 (JMO09_002008) - 2046081..2046641 (-) 561 WP_000046067.1 hypothetical protein -
  JMO09_RS10045 (JMO09_002009) - 2046628..2047065 (-) 438 WP_000270196.1 DUF3168 domain-containing protein -
  JMO09_RS10050 (JMO09_002010) - 2047078..2047491 (-) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  JMO09_RS10055 (JMO09_002011) - 2047478..2047813 (-) 336 WP_000482986.1 phage head closure protein -
  JMO09_RS10060 (JMO09_002012) - 2047806..2048120 (-) 315 WP_000338935.1 phage head-tail connector protein -
  JMO09_RS10065 (JMO09_002013) - 2048120..2048446 (-) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  JMO09_RS10070 (JMO09_002014) - 2048463..2049287 (-) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  JMO09_RS10075 (JMO09_002015) - 2049308..2049904 (-) 597 WP_000366932.1 phage scaffolding protein -
  JMO09_RS10080 (JMO09_002016) - 2050002..2050982 (-) 981 WP_001795666.1 phage head morphogenesis protein -
  JMO09_RS10085 (JMO09_002017) - 2050921..2052339 (-) 1419 WP_225305868.1 phage portal protein -
  JMO09_RS10090 (JMO09_002018) - 2052353..2053561 (-) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  JMO09_RS10095 (JMO09_002019) - 2053554..2054048 (-) 495 WP_000594082.1 terminase small subunit -
  JMO09_RS10100 (JMO09_002020) - 2054376..2054798 (-) 423 WP_000162702.1 RinA family phage transcriptional activator -
  JMO09_RS10105 (JMO09_002021) - 2054822..2054968 (-) 147 WP_000990005.1 hypothetical protein -
  JMO09_RS10110 (JMO09_002022) rinB 2054969..2055142 (-) 174 WP_001606759.1 transcriptional activator RinB -
  JMO09_RS10115 (JMO09_002023) - 2055135..2055371 (-) 237 WP_000483477.1 hypothetical protein -
  JMO09_RS10120 (JMO09_002024) - 2055396..2055632 (-) 237 WP_053040393.1 DUF1381 domain-containing protein -
  JMO09_RS10125 (JMO09_002025) - 2055649..2055822 (-) 174 WP_001209219.1 hypothetical protein -
  JMO09_RS10130 (JMO09_002026) - 2055859..2056395 (-) 537 WP_031789556.1 dUTPase -
  JMO09_RS10135 (JMO09_002027) - 2056388..2056636 (-) 249 WP_001065026.1 DUF1024 family protein -
  JMO09_RS10140 (JMO09_002028) - 2056629..2056913 (-) 285 WP_001105618.1 hypothetical protein -
  JMO09_RS10145 (JMO09_002029) - 2056910..2057311 (-) 402 WP_015978402.1 hypothetical protein -
  JMO09_RS10150 (JMO09_002030) - 2057324..2057572 (-) 249 WP_015980409.1 phi PVL orf 51-like protein -
  JMO09_RS10155 (JMO09_002031) - 2057573..2057932 (-) 360 WP_000117792.1 SA1788 family PVL leukocidin-associated protein -
  JMO09_RS10160 (JMO09_002032) - 2057933..2058118 (-) 186 WP_001187264.1 DUF3113 family protein -
  JMO09_RS10165 (JMO09_002033) - 2058118..2058525 (-) 408 WP_001599298.1 RusA family crossover junction endodeoxyribonuclease -
  JMO09_RS10170 (JMO09_002034) - 2058534..2058752 (-) 219 WP_000338528.1 hypothetical protein -
  JMO09_RS10175 (JMO09_002035) - 2058759..2059646 (-) 888 WP_220374341.1 DnaD domain protein -
  JMO09_RS10180 (JMO09_002036) ssbA 2059676..2060146 (-) 471 WP_000934768.1 single-stranded DNA-binding protein Machinery gene
  JMO09_RS10185 (JMO09_002037) - 2060147..2060764 (-) 618 WP_071890040.1 MBL fold metallo-hydrolase -
  JMO09_RS10190 (JMO09_002038) - 2060845..2061765 (-) 921 WP_000138475.1 recombinase RecT -
  JMO09_RS10195 (JMO09_002039) - 2061767..2063710 (-) 1944 WP_000700555.1 AAA family ATPase -
  JMO09_RS10200 (JMO09_002040) - 2063719..2063982 (-) 264 WP_001205732.1 hypothetical protein -
  JMO09_RS10205 (JMO09_002041) - 2063991..2064251 (-) 261 WP_000291075.1 DUF1108 family protein -
  JMO09_RS10210 (JMO09_002042) - 2064344..2064505 (-) 162 WP_001285964.1 DUF1270 domain-containing protein -
  JMO09_RS10215 (JMO09_002043) - 2064518..2064727 (-) 210 WP_031921283.1 hypothetical protein -
  JMO09_RS10220 (JMO09_002044) - 2064740..2065453 (-) 714 WP_220374342.1 BRO family protein -
  JMO09_RS10225 (JMO09_002045) - 2065510..2066112 (+) 603 WP_033863222.1 hypothetical protein -
  JMO09_RS10230 (JMO09_002046) - 2066125..2066265 (-) 141 WP_111689342.1 hypothetical protein -
  JMO09_RS10235 (JMO09_002047) - 2066249..2067031 (-) 783 WP_111689343.1 phage antirepressor KilAC domain-containing protein -
  JMO09_RS10240 (JMO09_002048) - 2067033..2067218 (-) 186 WP_000933365.1 helix-turn-helix domain-containing protein -
  JMO09_RS14935 - 2067661..2067795 (+) 135 WP_001119050.1 hypothetical protein -
  JMO09_RS10245 (JMO09_002049) - 2067792..2067995 (-) 204 WP_031905760.1 hypothetical protein -
  JMO09_RS10250 (JMO09_002050) - 2068011..2068265 (-) 255 WP_031790429.1 helix-turn-helix domain-containing protein -
  JMO09_RS10255 (JMO09_002051) - 2068456..2069094 (+) 639 WP_000874710.1 XRE family transcriptional regulator -
  JMO09_RS10260 (JMO09_002052) - 2069146..2069649 (+) 504 WP_000825944.1 hypothetical protein -
  JMO09_RS10265 (JMO09_002053) - 2069907..2070956 (+) 1050 WP_125571273.1 site-specific integrase -
  JMO09_RS10310 (JMO09_002062) - 2072165..2072719 (-) 555 WP_000132890.1 alpha/beta hydrolase -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17747.64 Da        Isoelectric Point: 4.9816

>NTDB_id=593949 JMO09_RS10180 WP_000934768.1 2059676..2060146(-) (ssbA) [Staphylococcus aureus strain HL17064]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=593949 JMO09_RS10180 WP_000934768.1 2059676..2060146(-) (ssbA) [Staphylococcus aureus strain HL17064]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365