Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   KZZ50_RS10160 Genome accession   NZ_CP080251
Coordinates   2044764..2045234 (-) Length   156 a.a.
NCBI ID   WP_000934760.1    Uniprot ID   A0AAN2D761
Organism   Staphylococcus aureus strain NT_611     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2014786..2068285 2044764..2045234 within 0


Gene organization within MGE regions


Location: 2014786..2068285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KZZ50_RS09955 (KZZ50_09925) scn 2014786..2015136 (-) 351 WP_000702262.1 complement inhibitor SCIN-A -
  KZZ50_RS09960 (KZZ50_09930) - 2015819..2016268 (+) 450 WP_000727645.1 chemotaxis-inhibiting protein CHIPS -
  KZZ50_RS09965 (KZZ50_09935) - 2016363..2016697 (-) 335 Protein_1930 SH3 domain-containing protein -
  KZZ50_RS09970 (KZZ50_09940) sak 2017348..2017839 (-) 492 WP_000920042.1 staphylokinase -
  KZZ50_RS09975 (KZZ50_09945) - 2018030..2018785 (-) 756 WP_000861026.1 CHAP domain-containing protein -
  KZZ50_RS09980 (KZZ50_09950) - 2018797..2019051 (-) 255 WP_000611512.1 phage holin -
  KZZ50_RS09985 (KZZ50_09955) - 2019103..2019210 (+) 108 WP_031762631.1 hypothetical protein -
  KZZ50_RS09990 (KZZ50_09960) pepG1 2019263..2019397 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  KZZ50_RS09995 (KZZ50_09965) sep 2019642..2020424 (-) 783 WP_000034846.1 staphylococcal enterotoxin type P -
  KZZ50_RS10000 (KZZ50_09970) - 2020831..2021205 (-) 375 WP_000340977.1 hypothetical protein -
  KZZ50_RS10005 (KZZ50_09975) - 2021261..2021548 (-) 288 WP_031865201.1 hypothetical protein -
  KZZ50_RS10010 (KZZ50_09980) - 2021594..2021746 (-) 153 WP_001000058.1 hypothetical protein -
  KZZ50_RS10015 (KZZ50_09985) - 2021739..2025521 (-) 3783 WP_031865200.1 phage tail spike protein -
  KZZ50_RS10020 (KZZ50_09990) - 2025537..2027021 (-) 1485 WP_000567390.1 phage tail domain-containing protein -
  KZZ50_RS10025 (KZZ50_09995) - 2027018..2031550 (-) 4533 WP_072519234.1 phage tail tape measure protein -
  KZZ50_RS14055 - 2031607..2031741 (-) 135 WP_000364140.1 hypothetical protein -
  KZZ50_RS10030 (KZZ50_10000) - 2031795..2032145 (-) 351 WP_001096355.1 hypothetical protein -
  KZZ50_RS10035 (KZZ50_10005) - 2032195..2032425 (-) 231 Protein_1945 Ig-like domain-containing protein -
  KZZ50_RS10040 (KZZ50_10010) - 2032461..2033105 (-) 645 WP_000268740.1 major tail protein -
  KZZ50_RS10045 (KZZ50_10015) - 2033106..2033513 (-) 408 WP_000565498.1 hypothetical protein -
  KZZ50_RS10050 (KZZ50_10020) - 2033510..2033914 (-) 405 WP_000114226.1 HK97 gp10 family phage protein -
  KZZ50_RS10055 (KZZ50_10025) - 2033911..2034273 (-) 363 WP_000755150.1 head-tail adaptor protein -
  KZZ50_RS10060 (KZZ50_10030) - 2034257..2034541 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  KZZ50_RS10065 (KZZ50_10035) - 2034531..2034815 (-) 285 WP_000238236.1 hypothetical protein -
  KZZ50_RS10070 (KZZ50_10040) - 2034835..2035980 (-) 1146 WP_000154559.1 phage major capsid protein -
  KZZ50_RS10075 (KZZ50_10045) - 2036004..2036741 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  KZZ50_RS10080 (KZZ50_10050) - 2036725..2037912 (-) 1188 WP_031902643.1 phage portal protein -
  KZZ50_RS10085 (KZZ50_10055) - 2037928..2039589 (-) 1662 WP_000625088.1 terminase large subunit -
  KZZ50_RS10090 (KZZ50_10060) - 2039586..2039930 (-) 345 WP_000402904.1 hypothetical protein -
  KZZ50_RS10095 (KZZ50_10065) - 2040060..2040359 (-) 300 WP_000988332.1 HNH endonuclease -
  KZZ50_RS10100 (KZZ50_10070) - 2040591..2041007 (-) 417 WP_000590122.1 hypothetical protein -
  KZZ50_RS10105 (KZZ50_10075) - 2041035..2041235 (-) 201 WP_000265043.1 DUF1514 family protein -
  KZZ50_RS10110 (KZZ50_10080) - 2041235..2041384 (-) 150 WP_000237868.1 transcriptional activator RinB -
  KZZ50_RS10115 (KZZ50_10085) - 2041387..2041587 (-) 201 WP_001125015.1 hypothetical protein -
  KZZ50_RS10120 (KZZ50_10090) - 2041562..2041750 (-) 189 WP_000195823.1 DUF1381 domain-containing protein -
  KZZ50_RS10125 (KZZ50_10095) - 2041787..2042320 (-) 534 WP_001668923.1 dUTP diphosphatase -
  KZZ50_RS10130 (KZZ50_10100) - 2042313..2042561 (-) 249 WP_001065085.1 DUF1024 family protein -
  KZZ50_RS10135 (KZZ50_10105) - 2042576..2042818 (-) 243 WP_031865197.1 phi PVL orf 51-like protein -
  KZZ50_RS10140 (KZZ50_10110) - 2042822..2043190 (-) 369 WP_000101275.1 SA1788 family PVL leukocidin-associated protein -
  KZZ50_RS10145 (KZZ50_10115) - 2043203..2043607 (-) 405 WP_000401958.1 RusA family crossover junction endodeoxyribonuclease -
  KZZ50_RS10150 (KZZ50_10120) - 2043616..2043834 (-) 219 WP_000338530.1 hypothetical protein -
  KZZ50_RS10155 (KZZ50_10125) - 2043841..2044734 (-) 894 WP_031865196.1 DnaD domain-containing protein -
  KZZ50_RS10160 (KZZ50_10130) ssbA 2044764..2045234 (-) 471 WP_000934760.1 single-stranded DNA-binding protein Machinery gene
  KZZ50_RS10165 (KZZ50_10135) - 2045235..2045852 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  KZZ50_RS10170 (KZZ50_10140) - 2045933..2046853 (-) 921 WP_000138473.1 recombinase RecT -
  KZZ50_RS10175 (KZZ50_10145) - 2046855..2048798 (-) 1944 WP_031865195.1 AAA family ATPase -
  KZZ50_RS10180 (KZZ50_10150) - 2048807..2049070 (-) 264 WP_001205732.1 hypothetical protein -
  KZZ50_RS10185 (KZZ50_10155) - 2049079..2049339 (-) 261 WP_000291488.1 DUF1108 family protein -
  KZZ50_RS10190 (KZZ50_10160) - 2049432..2049593 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  KZZ50_RS10195 (KZZ50_10165) - 2049590..2049910 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  KZZ50_RS10200 (KZZ50_10170) - 2049969..2050601 (+) 633 WP_000275058.1 hypothetical protein -
  KZZ50_RS10205 (KZZ50_10175) - 2050616..2050756 (-) 141 WP_000939496.1 hypothetical protein -
  KZZ50_RS10210 (KZZ50_10180) - 2050787..2050984 (-) 198 WP_001148861.1 hypothetical protein -
  KZZ50_RS10215 (KZZ50_10185) - 2051000..2051755 (-) 756 WP_217654524.1 phage antirepressor KilAC domain-containing protein -
  KZZ50_RS10220 (KZZ50_10190) - 2051812..2052351 (+) 540 WP_000351243.1 hypothetical protein -
  KZZ50_RS10225 (KZZ50_10195) - 2052375..2052635 (-) 261 WP_000435341.1 transcriptional regulator -
  KZZ50_RS10230 (KZZ50_10200) - 2052648..2052887 (-) 240 WP_000548576.1 helix-turn-helix transcriptional regulator -
  KZZ50_RS10235 (KZZ50_10205) - 2053058..2053765 (+) 708 WP_000094093.1 XRE family transcriptional regulator -
  KZZ50_RS10240 (KZZ50_10210) - 2053777..2053923 (+) 147 WP_001049401.1 hypothetical protein -
  KZZ50_RS10245 (KZZ50_10215) - 2053920..2054105 (+) 186 WP_000109192.1 hypothetical protein -
  KZZ50_RS10250 (KZZ50_10220) - 2054305..2054487 (+) 183 WP_000705240.1 hypothetical protein -
  KZZ50_RS10255 (KZZ50_10225) - 2054565..2055278 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  KZZ50_RS10260 (KZZ50_10230) - 2055470..2056507 (+) 1038 WP_000857185.1 site-specific integrase -
  KZZ50_RS10265 (KZZ50_10235) sph 2056558..2057388 (+) 831 Protein_1991 sphingomyelin phosphodiesterase -
  KZZ50_RS10270 (KZZ50_10240) lukG 2057626..2058642 (-) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  KZZ50_RS10275 (KZZ50_10245) lukH 2058664..2059716 (-) 1053 WP_000791415.1 bi-component leukocidin LukGH subunit H -
  KZZ50_RS10280 (KZZ50_10250) - 2060152..2061375 (+) 1224 WP_000206630.1 ArgE/DapE family deacylase -
  KZZ50_RS10285 (KZZ50_10255) - 2061873..2062742 (-) 870 WP_001108473.1 DMT family transporter -
  KZZ50_RS10290 (KZZ50_10260) hemA 2062745..2063947 (-) 1203 WP_000278575.1 5-aminolevulinate synthase -
  KZZ50_RS10295 (KZZ50_10265) - 2064463..2065770 (+) 1308 WP_001045345.1 TrkH family potassium uptake protein -
  KZZ50_RS10300 (KZZ50_10270) groL 2066309..2067925 (-) 1617 WP_000240642.1 chaperonin GroEL -
  KZZ50_RS10305 (KZZ50_10275) groES 2068001..2068285 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=591728 KZZ50_RS10160 WP_000934760.1 2044764..2045234(-) (ssbA) [Staphylococcus aureus strain NT_611]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=591728 KZZ50_RS10160 WP_000934760.1 2044764..2045234(-) (ssbA) [Staphylococcus aureus strain NT_611]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365