Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU505_RS04670 | Genome accession | NZ_CP077899 |
| Coordinates | 983487..983957 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934781.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 324 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 971622..1014331 | 983487..983957 | within | 0 |
Gene organization within MGE regions
Location: 971622..1014331
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU505_RS04585 (KU505_04550) | sufU | 971622..972086 (+) | 465 | WP_001010508.1 | Fe-S cluster assembly sulfur transfer protein SufU | - |
| KU505_RS04590 (KU505_04555) | sufB | 972237..973634 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| KU505_RS04595 (KU505_04560) | - | 973702..974751 (-) | 1050 | WP_001145728.1 | tyrosine-type recombinase/integrase | - |
| KU505_RS04600 (KU505_04565) | - | 974933..975901 (-) | 969 | WP_000429444.1 | DUF3644 domain-containing protein | - |
| KU505_RS04605 (KU505_04570) | - | 976085..976543 (-) | 459 | WP_000521397.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KU505_RS04610 (KU505_04575) | - | 976565..976891 (-) | 327 | WP_000455972.1 | helix-turn-helix domain-containing protein | - |
| KU505_RS04615 (KU505_04580) | - | 977054..977263 (+) | 210 | WP_001114715.1 | helix-turn-helix transcriptional regulator | - |
| KU505_RS04620 (KU505_04585) | - | 977302..978072 (+) | 771 | WP_111187481.1 | phage antirepressor | - |
| KU505_RS04625 | - | 978088..978156 (+) | 69 | Protein_903 | hypothetical protein | - |
| KU505_RS04630 (KU505_04590) | - | 978177..978842 (-) | 666 | WP_001807461.1 | hypothetical protein | - |
| KU505_RS04635 (KU505_04595) | - | 978913..979134 (+) | 222 | WP_000594792.1 | hypothetical protein | - |
| KU505_RS04640 (KU505_04600) | - | 979127..979288 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| KU505_RS04645 (KU505_04605) | - | 979382..979642 (+) | 261 | WP_000291080.1 | DUF1108 family protein | - |
| KU505_RS04650 (KU505_04610) | - | 979651..979914 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU505_RS04655 (KU505_04615) | - | 979923..981866 (+) | 1944 | WP_000700563.1 | AAA family ATPase | - |
| KU505_RS04660 (KU505_04620) | - | 981868..982788 (+) | 921 | WP_000138479.1 | recombinase RecT | - |
| KU505_RS04665 (KU505_04625) | - | 982869..983486 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| KU505_RS04670 (KU505_04630) | ssbA | 983487..983957 (+) | 471 | WP_000934781.1 | single-stranded DNA-binding protein | Machinery gene |
| KU505_RS04675 (KU505_04635) | - | 983987..984871 (+) | 885 | WP_000148309.1 | DnaD domain protein | - |
| KU505_RS04680 (KU505_04640) | - | 984878..985096 (+) | 219 | WP_225806015.1 | hypothetical protein | - |
| KU505_RS04685 (KU505_04645) | - | 985105..985509 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU505_RS04690 (KU505_04650) | - | 985522..985890 (+) | 369 | WP_225806016.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU505_RS04695 (KU505_04655) | - | 985894..986136 (+) | 243 | WP_000131384.1 | SAV1978 family virulence-associated passenger protein | - |
| KU505_RS04700 (KU505_04660) | - | 986201..986548 (+) | 348 | WP_000982696.1 | YopX family protein | - |
| KU505_RS04705 (KU505_04665) | - | 986545..986895 (+) | 351 | WP_141228648.1 | hypothetical protein | - |
| KU505_RS04710 (KU505_04670) | - | 986888..987136 (+) | 249 | WP_225806017.1 | DUF1024 family protein | - |
| KU505_RS04715 (KU505_04675) | - | 987129..987665 (+) | 537 | WP_225806018.1 | dUTPase | - |
| KU505_RS04720 (KU505_04680) | - | 987702..987908 (+) | 207 | WP_111187501.1 | DUF1381 domain-containing protein | - |
| KU505_RS04725 (KU505_04685) | rinB | 987905..988078 (+) | 174 | WP_000595254.1 | transcriptional activator RinB | - |
| KU505_RS04730 (KU505_04690) | - | 988079..988441 (+) | 363 | WP_000383792.1 | hypothetical protein | - |
| KU505_RS04735 (KU505_04695) | - | 988442..988588 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| KU505_RS04740 (KU505_04700) | - | 988612..989034 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| KU505_RS04745 (KU505_04705) | - | 989223..989664 (+) | 442 | Protein_927 | terminase small subunit | - |
| KU505_RS04750 (KU505_04710) | - | 989651..990925 (+) | 1275 | WP_000169950.1 | PBSX family phage terminase large subunit | - |
| KU505_RS04755 (KU505_04715) | - | 990937..992382 (+) | 1446 | WP_000219548.1 | phage portal protein | - |
| KU505_RS04760 (KU505_04720) | - | 992375..993319 (+) | 945 | Protein_930 | minor capsid protein | - |
| KU505_RS04765 (KU505_04725) | - | 993436..994059 (+) | 624 | WP_111187492.1 | DUF4355 domain-containing protein | - |
| KU505_RS04770 (KU505_04730) | - | 994078..994989 (+) | 912 | WP_001271960.1 | hypothetical protein | - |
| KU505_RS04775 (KU505_04735) | - | 995079..995528 (+) | 450 | WP_000087695.1 | Ig-like domain-containing protein | - |
| KU505_RS04780 (KU505_04740) | - | 995540..995872 (+) | 333 | WP_000120810.1 | phage head-tail connector protein | - |
| KU505_RS04785 (KU505_04745) | - | 995869..996183 (+) | 315 | WP_001270698.1 | hypothetical protein | - |
| KU505_RS04790 (KU505_04750) | - | 996173..996520 (+) | 348 | WP_001190834.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KU505_RS04795 (KU505_04755) | - | 996533..996928 (+) | 396 | WP_000921394.1 | hypothetical protein | - |
| KU505_RS04800 (KU505_04760) | - | 996946..997599 (+) | 654 | WP_001074452.1 | phage major tail protein, TP901-1 family | - |
| KU505_RS04805 (KU505_04765) | - | 997659..998039 (+) | 381 | WP_000259113.1 | tail assembly chaperone | - |
| KU505_RS04810 (KU505_04770) | - | 998069..998419 (+) | 351 | WP_001281461.1 | hypothetical protein | - |
| KU505_RS04815 (KU505_04775) | - | 998435..1001554 (+) | 3120 | WP_000064033.1 | hypothetical protein | - |
| KU505_RS04820 (KU505_04780) | - | 1001567..1002499 (+) | 933 | WP_048665712.1 | phage tail family protein | - |
| KU505_RS04825 (KU505_04785) | - | 1002512..1003909 (+) | 1398 | WP_000593860.1 | phage tail protein | - |
| KU505_RS04830 (KU505_04790) | - | 1003913..1004605 (+) | 693 | WP_000818132.1 | hypothetical protein | - |
| KU505_RS04835 (KU505_04795) | - | 1004617..1005660 (+) | 1044 | WP_000769013.1 | SGNH/GDSL hydrolase family protein | - |
| KU505_RS04840 (KU505_04800) | - | 1005677..1006948 (+) | 1272 | WP_000013196.1 | phage baseplate upper protein | - |
| KU505_RS04845 (KU505_04805) | - | 1006970..1007344 (+) | 375 | WP_000343402.1 | hypothetical protein | - |
| KU505_RS04850 (KU505_04810) | - | 1007469..1009355 (+) | 1887 | WP_001207581.1 | glucosaminidase domain-containing protein | - |
| KU505_RS04855 (KU505_04815) | sea | 1009798..1010571 (+) | 774 | WP_000750404.1 | staphylococcal enterotoxin type A | - |
| KU505_RS04860 (KU505_04820) | - | 1010733..1010837 (+) | 105 | WP_044122766.1 | hypothetical protein | - |
| KU505_RS04865 (KU505_04825) | - | 1010893..1010988 (-) | 96 | Protein_951 | hypothetical protein | - |
| KU505_RS04870 (KU505_04830) | - | 1011040..1011294 (+) | 255 | WP_000611512.1 | phage holin | - |
| KU505_RS04875 (KU505_04835) | - | 1011306..1012061 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU505_RS04880 (KU505_04840) | - | 1012287..1012415 (+) | 129 | WP_000884149.1 | hypothetical protein | - |
| KU505_RS04885 (KU505_04845) | - | 1012487..1012597 (+) | 111 | WP_000139425.1 | hypothetical protein | - |
| KU505_RS04890 (KU505_04850) | - | 1012599..1012784 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| KU505_RS04895 (KU505_04855) | - | 1013215..1013394 (+) | 180 | WP_000201921.1 | hypothetical protein | - |
| KU505_RS04900 (KU505_04860) | - | 1013416..1013943 (+) | 528 | WP_000455171.1 | Panacea domain-containing protein | - |
| KU505_RS04905 (KU505_04865) | - | 1013933..1014331 (+) | 399 | WP_000557463.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17602.28 Da Isoelectric Point: 4.6229
>NTDB_id=584815 KU505_RS04670 WP_000934781.1 983487..983957(+) (ssbA) [Staphylococcus aureus strain 324]
MLNRTVLVGRLTKDPEYRTTLNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
MLNRTVLVGRLTKDPEYRTTLNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=584815 KU505_RS04670 WP_000934781.1 983487..983957(+) (ssbA) [Staphylococcus aureus strain 324]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCTGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCTGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.887 |
100 |
0.679 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |