Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | KQ224_RS04840 | Genome accession | NZ_CP076721 |
| Coordinates | 954372..954575 (-) | Length | 67 a.a. |
| NCBI ID | WP_216807161.1 | Uniprot ID | - |
| Organism | Streptococcus parasuis strain H35 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 954372..989989 | 954372..954575 | within | 0 |
Gene organization within MGE regions
Location: 954372..989989
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQ224_RS04840 (KQ224_04840) | prx | 954372..954575 (-) | 204 | WP_216807161.1 | Paratox | Regulator |
| KQ224_RS04845 (KQ224_04845) | - | 954694..955533 (-) | 840 | WP_216807162.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KQ224_RS04850 (KQ224_04850) | - | 955639..955878 (-) | 240 | WP_216807163.1 | phage holin | - |
| KQ224_RS04855 (KQ224_04855) | - | 955880..956254 (-) | 375 | WP_216807356.1 | hypothetical protein | - |
| KQ224_RS04860 (KQ224_04860) | - | 956376..957797 (-) | 1422 | WP_216807164.1 | hypothetical protein | - |
| KQ224_RS04865 (KQ224_04865) | - | 957797..958318 (-) | 522 | WP_216807165.1 | hypothetical protein | - |
| KQ224_RS04870 (KQ224_04870) | - | 958318..958863 (-) | 546 | WP_216807166.1 | hypothetical protein | - |
| KQ224_RS04875 (KQ224_04875) | - | 958876..960456 (-) | 1581 | WP_216807167.1 | phage tail spike protein | - |
| KQ224_RS04880 (KQ224_04880) | - | 960459..961163 (-) | 705 | WP_216807168.1 | phage tail domain-containing protein | - |
| KQ224_RS04885 (KQ224_04885) | - | 961163..963346 (-) | 2184 | WP_216807169.1 | hypothetical protein | - |
| KQ224_RS04890 (KQ224_04890) | - | 963346..963582 (-) | 237 | WP_205713504.1 | peptide methionine sulfoxide reductase | - |
| KQ224_RS04895 (KQ224_04895) | - | 963663..964079 (-) | 417 | WP_216807170.1 | hypothetical protein | - |
| KQ224_RS04900 (KQ224_04900) | - | 964098..964688 (-) | 591 | WP_216807171.1 | hypothetical protein | - |
| KQ224_RS04905 (KQ224_04905) | - | 964688..965056 (-) | 369 | WP_216807172.1 | hypothetical protein | - |
| KQ224_RS04910 (KQ224_04910) | - | 965061..965489 (-) | 429 | WP_216807173.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KQ224_RS04915 (KQ224_04915) | - | 965482..965802 (-) | 321 | WP_216807174.1 | phage head closure protein | - |
| KQ224_RS04920 (KQ224_04920) | - | 965804..966334 (-) | 531 | WP_216807175.1 | hypothetical protein | - |
| KQ224_RS04925 (KQ224_04925) | - | 966372..966524 (-) | 153 | WP_216807176.1 | hypothetical protein | - |
| KQ224_RS04930 (KQ224_04930) | - | 966538..967449 (-) | 912 | WP_216807177.1 | hypothetical protein | - |
| KQ224_RS04935 (KQ224_04935) | - | 967472..968062 (-) | 591 | WP_216807178.1 | phage scaffolding protein | - |
| KQ224_RS04940 (KQ224_04940) | - | 968251..968448 (-) | 198 | WP_216807179.1 | hypothetical protein | - |
| KQ224_RS04945 (KQ224_04945) | - | 968450..970168 (-) | 1719 | WP_216807180.1 | phage minor head protein | - |
| KQ224_RS04950 (KQ224_04950) | - | 970143..971630 (-) | 1488 | WP_216807181.1 | phage portal protein | - |
| KQ224_RS04955 (KQ224_04955) | terL | 971645..973039 (-) | 1395 | WP_216807182.1 | phage terminase large subunit | - |
| KQ224_RS04960 (KQ224_04960) | - | 973029..973430 (-) | 402 | WP_253952870.1 | hypothetical protein | - |
| KQ224_RS04965 (KQ224_04965) | - | 973472..973936 (-) | 465 | WP_216807183.1 | hypothetical protein | - |
| KQ224_RS04970 (KQ224_04970) | - | 973940..974860 (-) | 921 | WP_216807184.1 | hypothetical protein | - |
| KQ224_RS04985 (KQ224_04985) | - | 975152..975613 (-) | 462 | WP_216807185.1 | DUF1492 domain-containing protein | - |
| KQ224_RS04990 (KQ224_04990) | - | 975693..975944 (-) | 252 | WP_216807186.1 | hypothetical protein | - |
| KQ224_RS04995 (KQ224_04995) | - | 975934..976329 (-) | 396 | WP_216807187.1 | hypothetical protein | - |
| KQ224_RS05000 (KQ224_05000) | - | 976331..976639 (-) | 309 | WP_216807188.1 | DUF1372 family protein | - |
| KQ224_RS05005 (KQ224_05005) | - | 976626..976844 (-) | 219 | WP_216807189.1 | hypothetical protein | - |
| KQ224_RS05010 (KQ224_05010) | - | 976831..977241 (-) | 411 | WP_216807190.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KQ224_RS05015 (KQ224_05015) | - | 977231..977464 (-) | 234 | WP_216807191.1 | hypothetical protein | - |
| KQ224_RS05020 (KQ224_05020) | - | 977851..980115 (-) | 2265 | WP_216807192.1 | AAA family ATPase | - |
| KQ224_RS05025 (KQ224_05025) | - | 980124..981707 (-) | 1584 | WP_216807193.1 | DEAD/DEAH box helicase | - |
| KQ224_RS05030 (KQ224_05030) | - | 981717..982280 (-) | 564 | WP_216807194.1 | hypothetical protein | - |
| KQ224_RS05035 (KQ224_05035) | - | 982352..983446 (-) | 1095 | WP_216807195.1 | ATP-binding protein | - |
| KQ224_RS05040 (KQ224_05040) | - | 983446..984738 (-) | 1293 | WP_216807196.1 | AAA family ATPase | - |
| KQ224_RS05045 (KQ224_05045) | - | 984748..985035 (-) | 288 | WP_216807197.1 | hypothetical protein | - |
| KQ224_RS05050 (KQ224_05050) | - | 985040..985192 (-) | 153 | WP_216807198.1 | hypothetical protein | - |
| KQ224_RS05055 (KQ224_05055) | - | 985182..985421 (-) | 240 | WP_216807199.1 | hypothetical protein | - |
| KQ224_RS05060 (KQ224_05060) | - | 985462..985716 (-) | 255 | WP_216807200.1 | hypothetical protein | - |
| KQ224_RS05065 (KQ224_05065) | - | 985877..986557 (+) | 681 | WP_216807201.1 | DUF4145 domain-containing protein | - |
| KQ224_RS11645 | - | 986515..986640 (-) | 126 | WP_301553950.1 | hypothetical protein | - |
| KQ224_RS05070 (KQ224_05070) | - | 986682..986873 (-) | 192 | WP_216807202.1 | hypothetical protein | - |
| KQ224_RS05075 (KQ224_05075) | - | 987183..987542 (+) | 360 | WP_216807203.1 | helix-turn-helix domain-containing protein | - |
| KQ224_RS05080 (KQ224_05080) | - | 987529..987912 (+) | 384 | WP_216807303.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KQ224_RS05085 (KQ224_05085) | - | 987923..988654 (+) | 732 | WP_216807204.1 | hypothetical protein | - |
| KQ224_RS05090 (KQ224_05090) | - | 988832..989989 (+) | 1158 | WP_216807205.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 67 a.a. Molecular weight: 7734.84 Da Isoelectric Point: 4.3491
>NTDB_id=577573 KQ224_RS04840 WP_216807161.1 954372..954575(-) (prx) [Streptococcus parasuis strain H35]
MLEYEELKEAVNNGYIIGNKINIVRRGGKIFDYVLPGEEVRPWEIVSEENVADVMRELKRPCPEVGE
MLEYEELKEAVNNGYIIGNKINIVRRGGKIFDYVLPGEEVRPWEIVSEENVADVMRELKRPCPEVGE
Nucleotide
Download Length: 204 bp
>NTDB_id=577573 KQ224_RS04840 WP_216807161.1 954372..954575(-) (prx) [Streptococcus parasuis strain H35]
ATGCTAGAATACGAAGAATTAAAAGAAGCGGTAAACAATGGGTATATAATAGGAAATAAAATTAATATCGTACGCCGAGG
TGGTAAGATATTTGATTACGTACTGCCTGGAGAAGAAGTTAGACCATGGGAGATTGTGAGCGAGGAGAATGTAGCGGATG
TGATGAGGGAATTAAAAAGACCTTGTCCAGAGGTCGGGGAGTAG
ATGCTAGAATACGAAGAATTAAAAGAAGCGGTAAACAATGGGTATATAATAGGAAATAAAATTAATATCGTACGCCGAGG
TGGTAAGATATTTGATTACGTACTGCCTGGAGAAGAAGTTAGACCATGGGAGATTGTGAGCGAGGAGAATGTAGCGGATG
TGATGAGGGAATTAAAAAGACCTTGTCCAGAGGTCGGGGAGTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
58.333 |
89.552 |
0.522 |
| prx | Streptococcus pyogenes MGAS315 |
55 |
89.552 |
0.493 |
| prx | Streptococcus pyogenes MGAS8232 |
53.333 |
89.552 |
0.478 |
| prx | Streptococcus pyogenes MGAS315 |
50 |
89.552 |
0.448 |
| prx | Streptococcus pyogenes MGAS315 |
64.286 |
62.687 |
0.403 |
| prx | Streptococcus pyogenes MGAS315 |
60.976 |
61.194 |
0.373 |