Detailed information
Overview
| Name | comGD/cglD | Type | Machinery gene |
| Locus tag | J4Q30_RS10190 | Genome accession | NZ_CP071917 |
| Coordinates | 1947353..1947757 (-) | Length | 134 a.a. |
| NCBI ID | WP_000588005.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 19A-19339 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1948507..1999921 | 1947353..1947757 | flank | 750 |
Gene organization within MGE regions
Location: 1947353..1999921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J4Q30_RS10190 (J4Q30_10185) | comGD/cglD | 1947353..1947757 (-) | 405 | WP_000588005.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| J4Q30_RS10195 (J4Q30_10190) | comGC/cglC | 1947750..1948016 (-) | 267 | WP_000962026.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| J4Q30_RS10200 (J4Q30_10195) | - | 1948018..1948275 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| J4Q30_RS10205 (J4Q30_10200) | - | 1948507..1949463 (-) | 957 | WP_233923013.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| J4Q30_RS10210 (J4Q30_10205) | - | 1949466..1949801 (-) | 336 | WP_050200954.1 | phage holin | - |
| J4Q30_RS10215 (J4Q30_10210) | - | 1949805..1950221 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| J4Q30_RS10220 (J4Q30_10215) | - | 1950231..1950581 (-) | 351 | WP_050200952.1 | hypothetical protein | - |
| J4Q30_RS10225 (J4Q30_10220) | - | 1950584..1950787 (-) | 204 | WP_001091109.1 | hypothetical protein | - |
| J4Q30_RS11785 | - | 1950768..1950884 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| J4Q30_RS10230 (J4Q30_10225) | - | 1950881..1960636 (-) | 9756 | WP_408669604.1 | tail fiber domain-containing protein | - |
| J4Q30_RS10235 (J4Q30_10235) | - | 1960677..1961027 (-) | 351 | WP_000068025.1 | DUF6711 family protein | - |
| J4Q30_RS10240 (J4Q30_10240) | - | 1961036..1964689 (-) | 3654 | WP_233922964.1 | hypothetical protein | - |
| J4Q30_RS10245 (J4Q30_10245) | - | 1964676..1965026 (-) | 351 | WP_000478016.1 | hypothetical protein | - |
| J4Q30_RS10250 (J4Q30_10250) | - | 1965065..1965445 (-) | 381 | WP_001185632.1 | DUF6096 family protein | - |
| J4Q30_RS10255 (J4Q30_10255) | - | 1965450..1965863 (-) | 414 | WP_000880676.1 | phage tail tube protein | - |
| J4Q30_RS10260 (J4Q30_10260) | - | 1965866..1966234 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| J4Q30_RS10265 (J4Q30_10265) | - | 1966231..1966746 (-) | 516 | WP_044812726.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| J4Q30_RS10270 (J4Q30_10270) | - | 1966721..1967059 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| J4Q30_RS10275 (J4Q30_10275) | - | 1967040..1967351 (-) | 312 | WP_000021221.1 | phage head-tail connector protein | - |
| J4Q30_RS10280 (J4Q30_10280) | - | 1967353..1967541 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| J4Q30_RS10285 (J4Q30_10285) | - | 1967531..1967713 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| J4Q30_RS10290 (J4Q30_10290) | - | 1967725..1968570 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| J4Q30_RS10295 (J4Q30_10295) | - | 1968577..1969161 (-) | 585 | WP_001288026.1 | DUF4355 domain-containing protein | - |
| J4Q30_RS10300 (J4Q30_10300) | - | 1969378..1969629 (-) | 252 | WP_000890163.1 | DUF6275 family protein | - |
| J4Q30_RS10305 (J4Q30_10305) | - | 1969631..1969876 (-) | 246 | WP_050221455.1 | hypothetical protein | - |
| J4Q30_RS10310 (J4Q30_10310) | - | 1969928..1970155 (-) | 228 | WP_050110656.1 | hypothetical protein | - |
| J4Q30_RS10315 (J4Q30_10315) | - | 1970143..1971546 (-) | 1404 | WP_225791470.1 | minor capsid protein | - |
| J4Q30_RS10320 (J4Q30_10320) | - | 1971455..1972924 (-) | 1470 | WP_078730733.1 | phage portal protein | - |
| J4Q30_RS10325 (J4Q30_10325) | - | 1972936..1974234 (-) | 1299 | WP_000084426.1 | PBSX family phage terminase large subunit | - |
| J4Q30_RS10330 (J4Q30_10330) | - | 1974212..1974652 (-) | 441 | WP_001859583.1 | terminase small subunit | - |
| J4Q30_RS10340 (J4Q30_10340) | - | 1975126..1975548 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| J4Q30_RS10345 (J4Q30_10345) | - | 1975618..1975983 (-) | 366 | WP_000802874.1 | hypothetical protein | - |
| J4Q30_RS10350 (J4Q30_10350) | - | 1975980..1976300 (-) | 321 | WP_320408135.1 | 3-dehydroquinate synthase | - |
| J4Q30_RS10355 (J4Q30_10355) | - | 1976556..1976735 (-) | 180 | WP_001042650.1 | hypothetical protein | - |
| J4Q30_RS10360 (J4Q30_10360) | - | 1976728..1977222 (-) | 495 | WP_233922966.1 | YopX family protein | - |
| J4Q30_RS10365 (J4Q30_10365) | - | 1977219..1977737 (-) | 519 | WP_233922967.1 | DUF1642 domain-containing protein | - |
| J4Q30_RS10370 (J4Q30_10370) | - | 1977739..1978056 (-) | 318 | WP_174222359.1 | hypothetical protein | - |
| J4Q30_RS10375 (J4Q30_10375) | - | 1978081..1978263 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| J4Q30_RS10380 (J4Q30_10380) | - | 1978279..1978710 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| J4Q30_RS10385 (J4Q30_10385) | - | 1978707..1979036 (-) | 330 | WP_050210841.1 | hypothetical protein | - |
| J4Q30_RS10390 (J4Q30_10390) | - | 1979050..1979259 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| J4Q30_RS10395 (J4Q30_10395) | - | 1979261..1979956 (-) | 696 | WP_050099130.1 | site-specific DNA-methyltransferase | - |
| J4Q30_RS10400 (J4Q30_10400) | ssbA | 1979969..1980385 (-) | 417 | WP_050201984.1 | single-stranded DNA-binding protein | Machinery gene |
| J4Q30_RS10405 (J4Q30_10405) | - | 1980375..1980518 (-) | 144 | WP_153277088.1 | hypothetical protein | - |
| J4Q30_RS10410 (J4Q30_10410) | - | 1980521..1981585 (-) | 1065 | WP_233922968.1 | DUF1351 domain-containing protein | - |
| J4Q30_RS10415 (J4Q30_10415) | bet | 1981595..1982347 (-) | 753 | WP_050263779.1 | phage recombination protein Bet | - |
| J4Q30_RS10420 (J4Q30_10420) | - | 1982365..1982550 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| J4Q30_RS10425 (J4Q30_10425) | - | 1982719..1982862 (-) | 144 | WP_001862963.1 | hypothetical protein | - |
| J4Q30_RS10430 (J4Q30_10430) | - | 1982849..1983109 (-) | 261 | WP_000471463.1 | hypothetical protein | - |
| J4Q30_RS10435 (J4Q30_10435) | - | 1983122..1983376 (-) | 255 | WP_000275521.1 | hypothetical protein | - |
| J4Q30_RS10440 (J4Q30_10440) | - | 1983377..1983598 (-) | 222 | WP_001864263.1 | hypothetical protein | - |
| J4Q30_RS10445 (J4Q30_10445) | - | 1983598..1983759 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| J4Q30_RS10450 (J4Q30_10450) | - | 1983824..1983967 (-) | 144 | WP_001862958.1 | hypothetical protein | - |
| J4Q30_RS10455 (J4Q30_10455) | - | 1984084..1984308 (+) | 225 | WP_000517704.1 | DUF2188 domain-containing protein | - |
| J4Q30_RS10460 (J4Q30_10460) | - | 1984305..1984487 (-) | 183 | WP_001247797.1 | hypothetical protein | - |
| J4Q30_RS10465 (J4Q30_10465) | - | 1984669..1984947 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| J4Q30_RS10470 (J4Q30_10470) | - | 1985114..1985350 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| J4Q30_RS11625 | - | 1985424..1985549 (+) | 126 | WP_257885839.1 | hypothetical protein | - |
| J4Q30_RS10475 (J4Q30_10480) | - | 1985542..1985841 (-) | 300 | WP_191855094.1 | hypothetical protein | - |
| J4Q30_RS10480 (J4Q30_10485) | - | 1985916..1986191 (-) | 276 | WP_050202804.1 | hypothetical protein | - |
| J4Q30_RS10485 (J4Q30_10490) | - | 1986352..1987104 (+) | 753 | WP_233922969.1 | XRE family transcriptional regulator | - |
| J4Q30_RS10490 (J4Q30_10495) | - | 1987106..1987870 (+) | 765 | WP_219576745.1 | hypothetical protein | - |
| J4Q30_RS10495 (J4Q30_10500) | - | 1988177..1989622 (+) | 1446 | WP_219576746.1 | recombinase family protein | - |
| J4Q30_RS10505 (J4Q30_10510) | comGB/cglB | 1989704..1990720 (-) | 1017 | WP_013193332.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| J4Q30_RS10510 (J4Q30_10515) | comGA/cglA/cilD | 1990668..1991609 (-) | 942 | WP_000249567.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| J4Q30_RS10515 (J4Q30_10520) | - | 1991685..1992050 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| J4Q30_RS10520 (J4Q30_10525) | - | 1992201..1993259 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| J4Q30_RS10525 (J4Q30_10530) | nagA | 1993422..1994573 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| J4Q30_RS10530 (J4Q30_10535) | - | 1994726..1996543 (-) | 1818 | WP_001220865.1 | acyltransferase family protein | - |
| J4Q30_RS10535 (J4Q30_10540) | tgt | 1996644..1997786 (-) | 1143 | WP_001285241.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| J4Q30_RS10540 (J4Q30_10545) | - | 1997916..1998773 (+) | 858 | WP_001108863.1 | DUF975 family protein | - |
| J4Q30_RS10545 (J4Q30_10550) | pcp | 1998801..1999445 (-) | 645 | WP_000866916.1 | pyroglutamyl-peptidase I | - |
| J4Q30_RS10550 (J4Q30_10555) | - | 1999520..1999921 (-) | 402 | WP_000022864.1 | DUF1304 domain-containing protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14636.81 Da Isoelectric Point: 10.2164
>NTDB_id=549059 J4Q30_RS10190 WP_000588005.1 1947353..1947757(-) (comGD/cglD) [Streptococcus pneumoniae strain 19A-19339]
MIKAFTMLESLLALSLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTISNGSQKLPV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
MIKAFTMLESLLALSLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTISNGSQKLPV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
Nucleotide
Download Length: 405 bp
>NTDB_id=549059 J4Q30_RS10190 WP_000588005.1 1947353..1947757(-) (comGD/cglD) [Streptococcus pneumoniae strain 19A-19339]
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGCTTTGAGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCAGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGATTAGCAATGGCAGTCAAAAGTTGCCAGTC
CCTAAAGGAATTCAGGCCCCATCAGGCCAAAGTATTACATTTGACCGTGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGCTTTGAGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCAGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGATTAGCAATGGCAGTCAAAAGTTGCCAGTC
CCTAAAGGAATTCAGGCCCCATCAGGCCAAAGTATTACATTTGACCGTGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus pneumoniae D39 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus pneumoniae R6 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
96.241 |
99.254 |
0.955 |
| comGD/cglD | Streptococcus mitis SK321 |
95.522 |
100 |
0.955 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
59.055 |
94.776 |
0.56 |
| comYD | Streptococcus mutans UA140 |
50 |
95.522 |
0.478 |
| comYD | Streptococcus mutans UA159 |
50 |
95.522 |
0.478 |