Detailed information NTG0546728

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: J3R86_RS06210
• Genome accession: NZ_CP071589
• Coordinates: 1391898..1392188 (-)
• Length: 96 a.a.
• NCBI ID: WP_278249701.1
• Uniprot ID: -
• Organism: Staphylococcus simiae strain 17941E
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1386898..1397188

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J3R86_RS06180 (J3R86_06180)	gcvPA	1387449..1388798 (-)	1350	WP_207516542.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
J3R86_RS06185 (J3R86_06185)	gcvT	1388820..1389911 (-)	1092	WP_207516543.1	glycine cleavage system aminomethyltransferase GcvT	-
J3R86_RS06190 (J3R86_06190)	-	1390087..1390611 (-)	525	WP_207516544.1	shikimate kinase	-
J3R86_RS06195 (J3R86_06195)	-	1390776..1391153 (-)	378	WP_207516545.1	competence type IV pilus minor pilin ComGF	-
J3R86_RS06200 (J3R86_06200)	-	1391191..1391484 (-)	294	WP_207516546.1	hypothetical protein	-
J3R86_RS06205 (J3R86_06205)	comGD	1391471..1391920 (-)	450	WP_207516547.1	competence type IV pilus minor pilin ComGD	Machinery gene
J3R86_RS06210 (J3R86_06210)	comGC	1391898..1392188 (-)	291	WP_278249701.1	competence type IV pilus major pilin ComGC	Machinery gene
J3R86_RS06215 (J3R86_06215)	comGB	1392224..1393294 (-)	1071	WP_207516549.1	competence type IV pilus assembly protein ComGB	Machinery gene
J3R86_RS06220 (J3R86_06220)	comGA	1393266..1394240 (-)	975	WP_207516550.1	competence type IV pilus ATPase ComGA	Machinery gene
J3R86_RS06225 (J3R86_06225)	-	1394292..1394915 (-)	624	WP_207516551.1	MBL fold metallo-hydrolase	-
J3R86_RS06230 (J3R86_06230)	-	1394917..1395240 (-)	324	WP_207516552.1	MTH1187 family thiamine-binding protein	-
J3R86_RS06235 (J3R86_06235)	-	1395240..1396226 (-)	987	WP_207516553.1	ROK family glucokinase	-
J3R86_RS06240 (J3R86_06240)	-	1396226..1396426 (-)	201	WP_095092718.1	YqgQ family protein	-

Sequence

Protein

• Length: 96 a.a.
• Molecular weight: 10508.44 Da
• Isoelectric Point: 7.1325

>NTDB_id=546728 J3R86_RS06210 WP_278249701.1 1391898..1392188(-) (comGC) [Staphylococcus simiae strain 17941E]
MKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHVQTTGCKAQVKMVNSQIEAYLLKHNSNPSTIDDLVAEGFIKEDQKTC
KSGEKITISNGEAVVN

Nucleotide

• Length: 291 bp

>NTDB_id=546728 J3R86_RS06210 WP_278249701.1 1391898..1392188(-) (comGC) [Staphylococcus simiae strain 17941E]
ATTAAAGCTTTTACCTTAATTGAGATGTTACTTGTTTTATTAATTATTAGTTTATTATTAATTTTAATCATACCTAATAT
AGCTAAACAAACAGCACATGTTCAAACGACTGGTTGCAAAGCCCAAGTGAAAATGGTGAATAGTCAAATAGAAGCATATT
TATTAAAGCATAATAGTAATCCATCAACGATTGACGACCTTGTCGCTGAAGGATTTATTAAGGAAGATCAAAAGACGTGT
AAATCTGGTGAGAAAATCACGATAAGTAATGGAGAAGCAGTTGTCAATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.316	98.958	0.854
comGC	Staphylococcus aureus MW2	86.316	98.958	0.854
comGC/cglC	Streptococcus mitis SK321	47.312	96.875	0.458
comGC/cglC	Streptococcus pneumoniae R6	46.237	96.875	0.448
comGC/cglC	Streptococcus pneumoniae TIGR4	46.237	96.875	0.448
comGC/cglC	Streptococcus pneumoniae Rx1	46.237	96.875	0.448
comGC/cglC	Streptococcus pneumoniae D39	46.237	96.875	0.448
comGC/cglC	Streptococcus mitis NCTC 12261	51.948	80.208	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	51.948	80.208	0.417
comYC	Streptococcus mutans UA140	51.948	80.208	0.417
comYC	Streptococcus mutans UA159	51.948	80.208	0.417
comGC	Bacillus subtilis subsp. subtilis str. 168	42.553	97.917	0.417
comYC	Streptococcus suis isolate S10	50.649	80.208	0.406
comGC	Lactococcus lactis subsp. cremoris KW2	48.101	82.292	0.396