Detailed information    

experimental Experimentally validated

Overview

Name   comC/comC1   Type   Regulator
Locus tag   H702_RS10235 Genome accession   NZ_AUZH01000012
Coordinates   7951..8094 (-) Length   47 a.a.
NCBI ID   WP_160172983.1    Uniprot ID   A0A091BVM0
Organism   Streptococcus equinus JB1     
Function   binding to ComD; induce autophosphorylation of ComD   
Competence regulation

Function

The transformation frequency was decreased by the disruption of comCD. Addition of recombinant ComC to S. bovis cultures increased the growth rate and transformation frequency.


Genomic Context

Location: 2951..13094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H702_RS09975 (H702_02405) - 3797..3961 (+) 165 WP_074799080.1 Blp family class II bacteriocin -
  H702_RS02325 (H702_02410) - 4003..4212 (+) 210 WP_039696224.1 hypothetical protein -
  H702_RS02335 (H702_02420) - 4472..5086 (+) 615 WP_052071090.1 thioredoxin fold domain-containing protein -
  H702_RS02345 (H702_02430) comE/comE1 5873..6604 (+) 732 WP_039696227.1 response regulator transcription factor Regulator
  H702_RS10470 comD/comD1 7219..7941 (+) 723 WP_236726575.1 sensor histidine kinase Regulator
  H702_RS10235 (H702_02440) comC/comC1 7951..8094 (-) 144 WP_160172983.1 hypothetical protein Regulator
  H702_RS02355 (H702_02445) - 8358..8507 (+) 150 WP_039696228.1 hypothetical protein -
  H702_RS02360 (H702_02450) - 8520..8825 (+) 306 WP_039696229.1 bacteriocin immunity protein -
  H702_RS02365 (H702_02455) - 8853..9146 (+) 294 WP_039696231.1 bacteriocin immunity protein -
  H702_RS02375 (H702_02465) comD/comD2 9933..10880 (+) 948 WP_160172984.1 sensor histidine kinase Regulator
  H702_RS02380 (H702_02470) comD/comD3 10877..12253 (+) 1377 WP_039696235.1 sensor histidine kinase Regulator

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comS comC/comC1 positive effect
  comR comC/comC1 positive effect
  comS comE/comE1 positive effect
  comR comE/comE1 positive effect

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5314.03 Da        Isoelectric Point: 5.7003

>NTDB_id=540 H702_RS10235 WP_160172983.1 7951..8094(-) (comC/comC1) [Streptococcus equinus JB1]
MTEWKMSESVKELTDSDLEKTVGGNGNPLLTGVVDWFKIFNKTKTHT

Nucleotide


Download         Length: 144 bp        

>NTDB_id=540 H702_RS10235 WP_160172983.1 7951..8094(-) (comC/comC1) [Streptococcus equinus JB1]
ATGACAGAATGGAAAATGTCAGAATCAGTCAAAGAATTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGAAATGGTAA
TCCTCTACTTACTGGTGTTGTTGATTGGTTTAAAATTTTTAATAAAACTAAAACACACACATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A091BVM0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Narito Asanuma et al. (2010) Involvement of two-component signal transduction system, ComDE, in the regulation of growth and genetic transformation, in the ruminal bacterium Streptococcus bovis. Anaerobe 16(4):405-11. [PMID: 20478389]