Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   I6G22_RS07170 Genome accession   NZ_CP065737
Coordinates   1353320..1353604 (+) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain FDAARGOS_865     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1348320..1358604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G22_RS07140 (I6G22_07145) comGA 1349911..1350849 (+) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene
  I6G22_RS07145 (I6G22_07150) comGB 1350743..1351816 (+) 1074 WP_074453836.1 competence type IV pilus assembly protein ComGB Machinery gene
  I6G22_RS07150 (I6G22_07155) comGC 1351944..1352213 (+) 270 WP_023188581.1 competence type IV pilus major pilin ComGC Machinery gene
  I6G22_RS07155 (I6G22_07160) comGD 1352188..1352604 (+) 417 WP_025017137.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6G22_RS07160 (I6G22_07165) comGE 1352576..1352872 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  I6G22_RS07165 (I6G22_07170) comGF 1352835..1353281 (+) 447 WP_032943612.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6G22_RS07170 (I6G22_07175) comGG 1353320..1353604 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  I6G22_RS07175 (I6G22_07180) - 1353694..1354131 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  I6G22_RS07180 (I6G22_07185) - 1354128..1354970 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  I6G22_RS07185 (I6G22_07190) - 1355147..1355884 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  I6G22_RS07190 (I6G22_07195) - 1355877..1356686 (+) 810 WP_014570791.1 metal ABC transporter permease -
  I6G22_RS07195 (I6G22_07200) - 1356724..1357590 (-) 867 WP_025017140.1 RluA family pseudouridine synthase -
  I6G22_RS07200 (I6G22_07205) - 1357795..1358172 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=513736 I6G22_RS07170 WP_025017139.1 1353320..1353604(+) (comGG) [Lactococcus lactis strain FDAARGOS_865]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=513736 I6G22_RS07170 WP_025017139.1 1353320..1353604(+) (comGG) [Lactococcus lactis strain FDAARGOS_865]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585