Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STCNRZ1202_RS01470 | Genome accession | NZ_CP065506 |
| Coordinates | 265977..266186 (+) | Length | 69 a.a. |
| NCBI ID | WP_270999752.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CNRZ1202 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 260977..271186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STCNRZ1202_RS01440 (STCNRZ1202_01455) | - | 261415..261924 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STCNRZ1202_RS01445 (STCNRZ1202_01460) | - | 262236..262793 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STCNRZ1202_RS01450 (STCNRZ1202_01465) | - | 262796..263446 (+) | 651 | WP_180476745.1 | phosphatase PAP2 family protein | - |
| STCNRZ1202_RS01455 (STCNRZ1202_01470) | comR | 263641..264540 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STCNRZ1202_RS01460 | - | 264778..265209 (+) | 432 | Protein_234 | cysteine peptidase family C39 domain-containing protein | - |
| STCNRZ1202_RS01465 | - | 265239..265868 (+) | 630 | Protein_235 | ABC transporter transmembrane domain-containing protein | - |
| STCNRZ1202_RS01470 | comA | 265977..266186 (+) | 210 | WP_270999752.1 | peptidase | Regulator |
| STCNRZ1202_RS01475 (STCNRZ1202_01495) | - | 266241..266809 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| STCNRZ1202_RS01480 (STCNRZ1202_01500) | - | 266917..267201 (+) | 285 | WP_347229667.1 | DUF805 domain-containing protein | - |
| STCNRZ1202_RS01485 | - | 267452..267799 (-) | 348 | WP_232089310.1 | DUF4173 domain-containing protein | - |
| STCNRZ1202_RS01490 | - | 267724..268620 (-) | 897 | WP_224103642.1 | urease cluster protein | - |
| STCNRZ1202_RS01495 (STCNRZ1202_01510) | - | 269026..269541 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STCNRZ1202_RS01500 (STCNRZ1202_01515) | - | 269566..269868 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STCNRZ1202_RS01505 (STCNRZ1202_01520) | - | 269880..270191 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8108.47 Da Isoelectric Point: 9.8218
>NTDB_id=511361 STCNRZ1202_RS01470 WP_270999752.1 265977..266186(+) (comA) [Streptococcus thermophilus strain CNRZ1202]
MITYSMLLNYFTTPLINIINLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIINLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=511361 STCNRZ1202_RS01470 WP_270999752.1 265977..266186(+) (comA) [Streptococcus thermophilus strain CNRZ1202]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCAATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCAATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
55.556 |
100 |
0.58 |
| comA | Streptococcus mitis NCTC 12261 |
54.167 |
100 |
0.565 |
| comA | Streptococcus pneumoniae Rx1 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae D39 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae R6 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae TIGR4 |
52.778 |
100 |
0.551 |
| comA | Streptococcus mitis SK321 |
51.389 |
100 |
0.536 |
| comA/nlmT | Streptococcus mutans UA159 |
45.714 |
100 |
0.464 |