Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | ST4021_RS01505 | Genome accession | NZ_CP065493 |
| Coordinates | 274366..274575 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 4021 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 269366..279575
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST4021_RS01475 (ST4021_01470) | - | 269805..270314 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ST4021_RS01480 (ST4021_01475) | - | 270625..271182 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| ST4021_RS01485 (ST4021_01480) | - | 271185..271835 (+) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| ST4021_RS01490 (ST4021_01485) | comR | 272030..272929 (+) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| ST4021_RS01495 | - | 273167..273748 (+) | 582 | Protein_241 | cysteine peptidase family C39 domain-containing protein | - |
| ST4021_RS01500 | comA | 273733..274023 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| ST4021_RS01505 | comA | 274366..274575 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ST4021_RS01510 (ST4021_01505) | - | 274630..275198 (+) | 569 | Protein_244 | ATP-binding cassette domain-containing protein | - |
| ST4021_RS01515 | - | 275429..275617 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| ST4021_RS01520 | - | 276110..276412 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| ST4021_RS01525 | - | 276636..277007 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| ST4021_RS01530 (ST4021_01520) | - | 277413..277928 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ST4021_RS01535 (ST4021_01525) | - | 277953..278255 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ST4021_RS01540 (ST4021_01530) | - | 278267..278578 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510942 ST4021_RS01505 WP_002946147.1 274366..274575(+) (comA) [Streptococcus thermophilus strain 4021]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510942 ST4021_RS01505 WP_002946147.1 274366..274575(+) (comA) [Streptococcus thermophilus strain 4021]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |