Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STAVA1121_RS01495 | Genome accession | NZ_CP065488 |
| Coordinates | 267771..267980 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain AVA1121 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 262771..272980
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STAVA1121_RS01470 (STAVA1121_01440) | - | 263211..263720 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STAVA1121_RS01475 (STAVA1121_01445) | - | 264030..264587 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| STAVA1121_RS01480 (STAVA1121_01450) | - | 264590..265240 (+) | 651 | WP_347131365.1 | phosphatase PAP2 family protein | - |
| STAVA1121_RS01485 (STAVA1121_01455) | comR | 265434..266333 (+) | 900 | WP_347114255.1 | XRE family transcriptional regulator | Regulator |
| STAVA1121_RS01490 (STAVA1121_01460) | - | 266571..267749 (+) | 1179 | Protein_240 | ABC transporter transmembrane domain-containing protein | - |
| STAVA1121_RS01495 | comA | 267771..267980 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STAVA1121_RS01500 (STAVA1121_01475) | - | 268035..268603 (+) | 569 | Protein_242 | ATP-binding cassette domain-containing protein | - |
| STAVA1121_RS01505 | - | 268834..269022 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| STAVA1121_RS01510 | - | 269030..269275 (-) | 246 | WP_233014559.1 | hypothetical protein | - |
| STAVA1121_RS01515 | - | 269244..269591 (-) | 348 | WP_347131367.1 | DUF4153 domain-containing protein | - |
| STAVA1121_RS01520 | - | 269516..270412 (-) | 897 | WP_347131368.1 | urease cluster protein | - |
| STAVA1121_RS01525 (STAVA1121_01490) | - | 270817..271332 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STAVA1121_RS01530 (STAVA1121_01495) | - | 271357..271659 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STAVA1121_RS01535 (STAVA1121_01500) | - | 271671..271982 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510647 STAVA1121_RS01495 WP_002946147.1 267771..267980(+) (comA) [Streptococcus thermophilus strain AVA1121]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510647 STAVA1121_RS01495 WP_002946147.1 267771..267980(+) (comA) [Streptococcus thermophilus strain AVA1121]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |