Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STT19_RS01465 | Genome accession | NZ_CP065487 |
| Coordinates | 262463..262606 (+) | Length | 47 a.a. |
| NCBI ID | WP_128887988.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST19 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257463..267606
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STT19_RS01435 (STT19_01435) | - | 258214..258723 (+) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STT19_RS01440 (STT19_01440) | - | 259034..259591 (+) | 558 | WP_071417478.1 | ECF transporter S component | - |
| STT19_RS01445 (STT19_01445) | - | 259594..260244 (+) | 651 | WP_071417477.1 | phosphatase PAP2 family protein | - |
| STT19_RS01450 (STT19_01450) | comR | 260439..261338 (+) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| STT19_RS01455 (STT19_01455) | - | 261576..262157 (+) | 582 | Protein_233 | cysteine peptidase family C39 domain-containing protein | - |
| STT19_RS01460 (STT19_01460) | comA | 262142..262432 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| STT19_RS01465 | comA | 262463..262606 (+) | 144 | WP_128887988.1 | hypothetical protein | Regulator |
| STT19_RS01470 | comA | 262775..262984 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STT19_RS01475 (STT19_01470) | - | 263039..263607 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| STT19_RS01480 | - | 263838..264026 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| STT19_RS01485 | - | 263994..264278 (-) | 285 | WP_232557103.1 | hypothetical protein | - |
| STT19_RS01490 | - | 264519..264821 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| STT19_RS01495 | - | 265045..265416 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| STT19_RS01500 (STT19_01485) | - | 265822..266337 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STT19_RS01505 (STT19_01490) | - | 266362..266664 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STT19_RS01510 (STT19_01495) | - | 266676..266987 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5602.55 Da Isoelectric Point: 8.5626
>NTDB_id=510583 STT19_RS01465 WP_128887988.1 262463..262606(+) (comA) [Streptococcus thermophilus strain ST19]
MIILAFYKLFEKENYQLMEANSQVNTAIIDDLRGIETLKSLRVKERR
MIILAFYKLFEKENYQLMEANSQVNTAIIDDLRGIETLKSLRVKERR
Nucleotide
Download Length: 144 bp
>NTDB_id=510583 STT19_RS01465 WP_128887988.1 262463..262606(+) (comA) [Streptococcus thermophilus strain ST19]
TTGATTATTCTGGCCTTTTATAAGCTTTTTGAGAAGGAAAATTATCAATTAATGGAGGCAAATAGTCAGGTCAATACTGC
TATTATTGATGATTTACGTGGTATTGAAACTTTAAAATCTTTAAGAGTTAAAGAGAGACGTTAG
TTGATTATTCTGGCCTTTTATAAGCTTTTTGAGAAGGAAAATTATCAATTAATGGAGGCAAATAGTCAGGTCAATACTGC
TATTATTGATGATTTACGTGGTATTGAAACTTTAAAATCTTTAAGAGTTAAAGAGAGACGTTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus pneumoniae TIGR4 |
51.064 |
100 |
0.511 |
| comA | Streptococcus gordonii str. Challis substr. CH1 |
51.064 |
100 |
0.511 |
| comA | Streptococcus mitis NCTC 12261 |
51.064 |
100 |
0.511 |
| comA | Streptococcus pneumoniae Rx1 |
51.064 |
100 |
0.511 |
| comA | Streptococcus pneumoniae D39 |
51.064 |
100 |
0.511 |
| comA | Streptococcus pneumoniae R6 |
51.064 |
100 |
0.511 |
| comA | Streptococcus mitis SK321 |
51.064 |
100 |
0.511 |
| comA/nlmT | Streptococcus mutans UA159 |
48.936 |
100 |
0.489 |