Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STR1_RS01445 | Genome accession | NZ_CP065486 |
| Coordinates | 272806..273015 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain R1 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 267806..278015
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STR1_RS01420 (STR1_01415) | - | 268243..268752 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STR1_RS01425 (STR1_01420) | - | 269064..269621 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STR1_RS01430 (STR1_01425) | - | 269624..270274 (+) | 651 | WP_095559229.1 | phosphatase PAP2 family protein | - |
| STR1_RS01435 (STR1_01430) | comR | 270469..271368 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STR1_RS01440 (STR1_01435) | - | 271606..272784 (+) | 1179 | Protein_243 | ABC transporter transmembrane domain-containing protein | - |
| STR1_RS01445 | comA | 272806..273015 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STR1_RS01450 (STR1_01450) | - | 273070..273638 (+) | 569 | Protein_245 | ATP-binding cassette domain-containing protein | - |
| STR1_RS01455 (STR1_01455) | - | 273765..274076 (+) | 312 | WP_095559231.1 | DUF805 domain-containing protein | - |
| STR1_RS01460 | - | 274044..274328 (-) | 285 | WP_232085805.1 | hypothetical protein | - |
| STR1_RS01465 | - | 274568..275464 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| STR1_RS01470 (STR1_01465) | - | 275869..276384 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STR1_RS01475 (STR1_01470) | - | 276409..276711 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STR1_RS01480 (STR1_01475) | - | 276723..277034 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510522 STR1_RS01445 WP_002946147.1 272806..273015(+) (comA) [Streptococcus thermophilus strain R1]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510522 STR1_RS01445 WP_002946147.1 272806..273015(+) (comA) [Streptococcus thermophilus strain R1]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |