Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | ST90729_RS01485 | Genome accession | NZ_CP065480 |
| Coordinates | 271757..271966 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 90729 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 266757..276966
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST90729_RS01460 (ST90729_01455) | - | 267193..267702 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ST90729_RS01465 (ST90729_01460) | - | 268015..268572 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| ST90729_RS01470 (ST90729_01465) | - | 268575..269225 (+) | 651 | WP_022096567.1 | phosphatase PAP2 family protein | - |
| ST90729_RS01475 (ST90729_01470) | comR | 269420..270319 (+) | 900 | WP_011225448.1 | helix-turn-helix domain-containing protein | Regulator |
| ST90729_RS01480 (ST90729_01475) | - | 270557..271735 (+) | 1179 | Protein_238 | ABC transporter transmembrane domain-containing protein | - |
| ST90729_RS01485 | comA | 271757..271966 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ST90729_RS01490 (ST90729_01490) | - | 272021..272589 (+) | 569 | Protein_240 | ATP-binding cassette domain-containing protein | - |
| ST90729_RS01495 (ST90729_01495) | - | 272697..273008 (+) | 312 | WP_022096570.1 | DUF805 domain-containing protein | - |
| ST90729_RS01500 | - | 272976..273260 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| ST90729_RS01505 | - | 273675..273809 (-) | 135 | WP_259700431.1 | hypothetical protein | - |
| ST90729_RS01510 | - | 274033..274404 (-) | 372 | WP_232510006.1 | hypothetical protein | - |
| ST90729_RS01515 (ST90729_01505) | - | 274809..275324 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ST90729_RS01520 (ST90729_01510) | - | 275349..275651 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ST90729_RS01525 (ST90729_01515) | - | 275663..275974 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510171 ST90729_RS01485 WP_002946147.1 271757..271966(+) (comA) [Streptococcus thermophilus strain 90729]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510171 ST90729_RS01485 WP_002946147.1 271757..271966(+) (comA) [Streptococcus thermophilus strain 90729]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |