Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STH8232_RS11660 | Genome accession | NC_017581 |
| Coordinates | 295962..296171 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus JIM 8232 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 290962..301171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STH8232_RS01600 (STH8232_0360) | - | 291370..291909 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STH8232_RS01605 (STH8232_0361) | - | 292220..292777 (+) | 558 | WP_014621138.1 | ECF transporter S component | - |
| STH8232_RS01610 (STH8232_0362) | - | 292780..293430 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| STH8232_RS01615 (STH8232_0364) | comR | 293625..294524 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STH8232_RS11650 | - | 294762..295193 (+) | 432 | Protein_264 | cysteine peptidase family C39 domain-containing protein | - |
| STH8232_RS11655 | - | 295401..295940 (+) | 540 | Protein_265 | ABC transporter transmembrane domain-containing protein | - |
| STH8232_RS11660 (STH8232_0370) | comA | 295962..296171 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STH8232_RS01640 (STH8232_0372) | - | 296226..296794 (+) | 569 | Protein_267 | ATP-binding cassette domain-containing protein | - |
| STH8232_RS01645 (STH8232_0373) | - | 296902..297219 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STH8232_RS11665 | - | 297182..297466 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| STH8232_RS11670 (STH8232_0374) | - | 297706..298008 (-) | 303 | WP_014621146.1 | hypothetical protein | - |
| STH8232_RS11675 (STH8232_0375) | - | 298123..298602 (-) | 480 | WP_231838386.1 | hypothetical protein | - |
| STH8232_RS01655 (STH8232_0376) | - | 299007..299522 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STH8232_RS01660 (STH8232_0377) | - | 299547..299849 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STH8232_RS01665 (STH8232_0378) | - | 299861..300172 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=49025 STH8232_RS11660 WP_002946147.1 295962..296171(+) (comA) [Streptococcus thermophilus JIM 8232]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=49025 STH8232_RS11660 WP_002946147.1 295962..296171(+) (comA) [Streptococcus thermophilus JIM 8232]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |