Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STND_RS11460 | Genome accession | NC_017563 |
| Coordinates | 267385..267594 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus ND03 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 262385..272594
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STND_RS01465 (STND_0264) | - | 262823..263332 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STND_RS01470 (STND_0265) | - | 263644..264201 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STND_RS01475 (STND_0266) | - | 264204..264854 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| STND_RS01480 (STND_0267) | comR | 265049..265948 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STND_RS11450 | - | 266186..266617 (+) | 432 | Protein_244 | cysteine peptidase family C39 domain-containing protein | - |
| STND_RS11455 | - | 266647..267312 (+) | 666 | Protein_245 | ABC transporter transmembrane domain-containing protein | - |
| STND_RS11460 | comA | 267385..267594 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STND_RS01505 | - | 267649..268217 (+) | 569 | Protein_247 | ATP-binding cassette domain-containing protein | - |
| STND_RS01510 (STND_0271) | - | 268325..268642 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STND_RS11465 | - | 268605..268889 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| STND_RS11470 | - | 269129..270025 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| STND_RS01520 (STND_0273) | - | 270430..270945 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STND_RS01525 (STND_0274) | - | 270970..271272 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STND_RS01530 (STND_0275) | - | 271284..271595 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=48738 STND_RS11460 WP_002946147.1 267385..267594(+) (comA) [Streptococcus thermophilus ND03]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=48738 STND_RS11460 WP_002946147.1 267385..267594(+) (comA) [Streptococcus thermophilus ND03]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |