Detailed information NTG0482423

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: J7T77_RS08805
• Genome accession: NZ_CP072430
• Coordinates: 1694291..1694719 (-)
• Length: 142 a.a.
• NCBI ID: WP_253269448.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24746
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1689291..1699719

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T77_RS08765 (J7T77_08645)	-	1689430..1689873 (-)	444	WP_084829882.1	CAAX protease	-
J7T77_RS08770	-	1689947..1690372 (-)	426	WP_087010196.1	CPBP family intramembrane glutamic endopeptidase	-
J7T77_RS08775 (J7T77_08655)	-	1690614..1690811 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T77_RS08780 (J7T77_08660)	-	1691060..1692253 (-)	1194	WP_084831204.1	acetate kinase	-
J7T77_RS08785 (J7T77_08665)	comGH	1692309..1693265 (-)	957	WP_084831205.1	class I SAM-dependent methyltransferase	Machinery gene
J7T77_RS08790 (J7T77_08670)	comGG	1693310..1693627 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	Machinery gene
J7T77_RS08795 (J7T77_08675)	comGF	1693605..1694042 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T77_RS08800 (J7T77_08680)	comGE	1694026..1694319 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	Machinery gene
J7T77_RS08805 (J7T77_08685)	comGD	1694291..1694719 (-)	429	WP_253269448.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T77_RS08810 (J7T77_08690)	comGC	1694679..1695005 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T77_RS08815 (J7T77_08695)	comGB	1695002..1696102 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7T77_RS08820 (J7T77_08700)	comGA/cglA/cilD	1695984..1696925 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T77_RS08825 (J7T77_08705)	-	1697006..1697368 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15829.42 Da
• Isoelectric Point: 10.3330

>NTDB_id=482423 J7T77_RS08805 WP_253269448.1 1694291..1694719(-) (comGD) [Streptococcus thermophilus strain S24746]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVGNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=482423 J7T77_RS08805 WP_253269448.1 1694291..1694719(-) (comGD) [Streptococcus thermophilus strain S24746]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTGGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGGGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus mutans UA140	51.908	92.254	0.479
comGD	Streptococcus mutans UA159	51.908	92.254	0.479
comGD	Streptococcus gordonii str. Challis substr. CH1	40.714	98.592	0.401
comGD/cglD	Streptococcus pneumoniae Rx1	43.307	89.437	0.387
comGD/cglD	Streptococcus pneumoniae D39	43.307	89.437	0.387
comGD/cglD	Streptococcus pneumoniae R6	43.307	89.437	0.387
comGD/cglD	Streptococcus mitis NCTC 12261	43.307	89.437	0.387
comGD/cglD	Streptococcus pneumoniae TIGR4	43.307	89.437	0.387
comGD/cglD	Streptococcus mitis SK321	42.52	89.437	0.38
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38