Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | IBC03_RS09935 | Genome accession | NZ_CP061025 |
| Coordinates | 275636..275845 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 13496 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 270636..280845
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IBC03_RS01495 (IBC03_01500) | - | 271074..271583 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| IBC03_RS01500 (IBC03_01505) | - | 271895..272452 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| IBC03_RS01505 (IBC03_01510) | - | 272455..273105 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| IBC03_RS01510 (IBC03_01515) | comR | 273300..274199 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| IBC03_RS09925 | - | 274437..274868 (+) | 432 | Protein_244 | cysteine peptidase family C39 domain-containing protein | - |
| IBC03_RS09930 | - | 274898..275614 (+) | 717 | Protein_245 | ABC transporter transmembrane domain-containing protein | - |
| IBC03_RS09935 | comA | 275636..275845 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| IBC03_RS01535 (IBC03_01540) | - | 275900..276468 (+) | 569 | Protein_247 | ATP-binding cassette domain-containing protein | - |
| IBC03_RS01540 (IBC03_01545) | - | 276583..277518 (+) | 936 | WP_138496752.1 | IS30 family transposase | - |
| IBC03_RS01545 (IBC03_01550) | - | 277637..277954 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| IBC03_RS09940 | - | 277917..278201 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| IBC03_RS09945 | - | 278441..279337 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| IBC03_RS01555 (IBC03_01560) | - | 279742..280257 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| IBC03_RS01560 (IBC03_01565) | - | 280282..280584 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=479849 IBC03_RS09935 WP_002946147.1 275636..275845(+) (comA) [Streptococcus thermophilus strain 13496]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=479849 IBC03_RS09935 WP_002946147.1 275636..275845(+) (comA) [Streptococcus thermophilus strain 13496]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |