Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | IBB97_RS10175 | Genome accession | NZ_CP061021 |
| Coordinates | 274573..274782 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 24739 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 269573..279782
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IBB97_RS01490 (IBB97_01495) | - | 270011..270520 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| IBB97_RS01495 (IBB97_01500) | - | 270832..271389 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| IBB97_RS01500 (IBB97_01505) | - | 271392..272042 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| IBB97_RS01505 (IBB97_01510) | comR | 272237..273136 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| IBB97_RS10165 | - | 273374..273805 (+) | 432 | Protein_243 | cysteine peptidase family C39 domain-containing protein | - |
| IBB97_RS10170 | - | 273835..274551 (+) | 717 | Protein_244 | ABC transporter transmembrane domain-containing protein | - |
| IBB97_RS10175 | comA | 274573..274782 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| IBB97_RS01530 (IBB97_01535) | - | 274837..275405 (+) | 569 | Protein_246 | ATP-binding cassette domain-containing protein | - |
| IBB97_RS01535 (IBB97_01540) | - | 275520..276455 (+) | 936 | WP_138496752.1 | IS30 family transposase | - |
| IBB97_RS01540 (IBB97_01545) | - | 276574..276891 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| IBB97_RS10180 | - | 276854..277138 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| IBB97_RS10185 | - | 277378..278274 (-) | 897 | WP_242685116.1 | urease cluster protein | - |
| IBB97_RS01550 (IBB97_01555) | - | 278679..279194 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| IBB97_RS01555 (IBB97_01560) | - | 279219..279521 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=479620 IBB97_RS10175 WP_002946147.1 274573..274782(+) (comA) [Streptococcus thermophilus strain 24739]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=479620 IBB97_RS10175 WP_002946147.1 274573..274782(+) (comA) [Streptococcus thermophilus strain 24739]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |