Detailed information NTG0047720

Bioinformatically predicted

Overview

• Name: comFC
• Type: Machinery gene
• Locus tag: LLH_RS14300
• Genome accession: NC_017492
• Coordinates: 1107871..1108245 (-)
• Length: 124 a.a.
• NCBI ID: WP_014572518.1
• Uniprot ID: -
• Organism: Lactococcus cremoris subsp. cremoris A76
• Function: ssDNA transport into the cell (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1106931..1107785	1107871..1108245	flank	86

Gene organization within MGE regions

Location: 1106931..1108245

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLH_RS05690 (llh_5960)	-	1106931..1107820 (+)	890	Protein_1106	IS982 family transposase	-
LLH_RS14300 (llh_5965)	comFC	1107871..1108245 (-)	375	WP_014572518.1	ComF family protein	Machinery gene

Sequence

Protein

• Length: 124 a.a.
• Molecular weight: 14378.65 Da
• Isoelectric Point: 10.0026

>NTDB_id=47720 LLH_RS14300 WP_014572518.1 1107871..1108245(-) (comFC) [Lactococcus cremoris subsp. cremoris A76]
MGDYRLHEVFDSYFKNLSKKIPLVPIPVSPKRLQERGFNQVTAFLKDRAYLDLLEKEDTVRQSSLNREGRLSTSNPFKLK
EGEKIPQKIILIDDIYTTGTTFYHAIKTLKKANPIEITTFSLCR

Nucleotide

• Length: 375 bp

>NTDB_id=47720 LLH_RS14300 WP_014572518.1 1107871..1108245(-) (comFC) [Lactococcus cremoris subsp. cremoris A76]
ATGGGAGATTATCGATTACACGAAGTCTTCGATTCCTATTTTAAAAATTTGTCCAAAAAAATTCCTCTGGTTCCCATTCC
GGTTTCTCCTAAAAGATTACAAGAAAGAGGTTTTAACCAAGTAACAGCTTTTCTAAAAGATAGAGCTTATCTTGATTTGC
TTGAAAAAGAGGATACTGTCAGACAATCAAGTCTTAATCGCGAGGGACGTCTATCAACTAGCAATCCTTTTAAGTTGAAA
GAGGGTGAAAAAATACCCCAAAAAATCATTTTGATTGATGATATTTATACAACTGGAACTACTTTTTATCATGCAATAAA
AACCTTAAAGAAAGCTAATCCGATTGAAATTACAACTTTCTCACTCTGCCGTTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comFC	Lactococcus lactis subsp. cremoris KW2	98.387	100	0.984
comFC/cflB	Streptococcus mitis NCTC 12261	49.219	100	0.508
comFC/cflB	Streptococcus pneumoniae Rx1	46.875	100	0.484
comFC/cflB	Streptococcus pneumoniae D39	46.875	100	0.484
comFC/cflB	Streptococcus pneumoniae R6	46.875	100	0.484
comFC/cflB	Streptococcus pneumoniae TIGR4	46.875	100	0.484
comFC/cflB	Streptococcus mitis SK321	46.094	100	0.476
comFC	Latilactobacillus sakei subsp. sakei 23K	36.567	100	0.395
comFC	Bacillus subtilis subsp. subtilis str. 168	36.364	100	0.387