NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	HW271_RS05965	Genome accession	NZ_CP058258
Coordinates	1213997..1214467 (-)	Length	156 a.a.
NCBI ID	WP_178895252.1	Uniprot ID	-
Organism	Streptococcus sp. oral taxon 061 strain F0704
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1208997..1219467

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HW271_RS05930 (HW271_05930)	-	1209113..1210048 (-)	936	WP_048689738.1	manganese-dependent inorganic pyrophosphatase	-
HW271_RS05935 (HW271_05935)	-	1210134..1210418 (-)	285	WP_178895248.1	GIY-YIG nuclease family protein	-
HW271_RS05940 (HW271_05940)	-	1210408..1211157 (-)	750	WP_178895249.1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	-
HW271_RS05945 (HW271_05945)	-	1211206..1211568 (-)	363	WP_004252382.1	S1 RNA-binding domain-containing protein	-
HW271_RS05950 (HW271_05950)	-	1211570..1212970 (-)	1401	WP_178895250.1	bifunctional Cof-type HAD-IIB family hydrolase/peptidylprolyl isomerase	-
HW271_RS05955 (HW271_05955)	-	1213052..1213555 (-)	504	WP_178895251.1	GNAT family N-acetyltransferase	-
HW271_RS05960 (HW271_05960)	rpsR	1213726..1213965 (-)	240	WP_000068664.1	30S ribosomal protein S18	-
HW271_RS05965 (HW271_05965)	ssbA	1213997..1214467 (-)	471	WP_178895252.1	single-stranded DNA-binding protein SsbA	Machinery gene
HW271_RS05970 (HW271_05970)	rpsF	1214479..1214769 (-)	291	WP_002896497.1	30S ribosomal protein S6	-
HW271_RS05975 (HW271_05975)	-	1214898..1215554 (-)	657	WP_178895253.1	CBS domain-containing protein	-
HW271_RS05980 (HW271_05980)	-	1215814..1216524 (-)	711	WP_178895254.1	ABC transporter ATP-binding protein	-
HW271_RS05985 (HW271_05985)	-	1216524..1217288 (-)	765	WP_178895255.1	ABC transporter ATP-binding protein	-
HW271_RS05990 (HW271_05990)	-	1217288..1218244 (-)	957	WP_178895256.1	branched-chain amino acid ABC transporter permease	-
HW271_RS05995 (HW271_05995)	-	1218248..1219117 (-)	870	WP_178895257.1	branched-chain amino acid ABC transporter permease	-

Sequence

Protein

Download Length: 156 a.a. Molecular weight: 17347.18 Da Isoelectric Point: 4.9164

                                >NTDB_id=463227 HW271_RS05965 WP_178895252.1 1213997..1214467(-) (ssbA) [Streptococcus sp. oral taxon 061 strain F0704]

MINNVVLVGRMVRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTR

SYDNQQGQRVYVTEVVAENFQMLESRSVREGQTGGGHSAPSSNYSAPTQSVPDFSRDENPFGTTNPLDISDDDLPF

Nucleotide

Download Length: 471 bp

                                >NTDB_id=463227 HW271_RS05965 WP_178895252.1 1213997..1214467(-) (ssbA) [Streptococcus sp. oral taxon 061 strain F0704]

ATGATTAACAATGTTGTACTTGTAGGGCGTATGGTACGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTAGC

TACTTTTACTCTTGCAGTAAACCGTACATTCAAGAGTCAAAATGGTGAACGTGAGGCTGATTTTATCAATGTCGTAATGT

GGCGCCAACAGGCTGAAAACCTTGCTAACTGGGCTAAAAAAGGCTCACTTATCGGGGTTACAGGTCGTATCCAGACTCGT

AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACTGAAGTCGTAGCTGAAAATTTCCAAATGTTGGAAAGCCGTAG

CGTGCGTGAAGGTCAAACTGGTGGAGGTCATTCTGCACCAAGTTCAAATTATTCAGCACCTACACAATCAGTACCTGACT

TTTCACGAGATGAAAATCCATTTGGAACAACCAATCCATTGGATATTTCAGACGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	55.233	100	0.609
ssb	Latilactobacillus sakei subsp. sakei 23K	54.706	100	0.596
ssbB	Streptococcus sobrinus strain NIDR 6715-7	50.847	75.641	0.385
ssbB	Bacillus subtilis subsp. subtilis str. 168	54.717	67.949	0.372
ssb	Glaesserella parasuis strain SC1401	31.667	100	0.365
ssbB/cilA	Streptococcus pneumoniae TIGR4	52.294	69.872	0.365

Detailed information NTG0463227