Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | HEQ84_RS01470 | Genome accession | NZ_CP050870 |
| Coordinates | 262960..263169 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS6 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257960..268169
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HEQ84_RS01440 (HEQ84_01430) | - | 258399..258908 (+) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| HEQ84_RS01445 (HEQ84_01435) | - | 259219..259776 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| HEQ84_RS01450 (HEQ84_01440) | - | 259779..260429 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| HEQ84_RS01455 (HEQ84_01445) | comR | 260624..261523 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| HEQ84_RS01460 | - | 261761..262192 (+) | 432 | Protein_235 | cysteine peptidase family C39 domain-containing protein | - |
| HEQ84_RS01465 | - | 262222..262938 (+) | 717 | Protein_236 | ABC transporter transmembrane domain-containing protein | - |
| HEQ84_RS01470 | comA | 262960..263169 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| HEQ84_RS01475 (HEQ84_01465) | - | 263224..263792 (+) | 569 | Protein_238 | ATP-binding cassette domain-containing protein | - |
| HEQ84_RS01480 (HEQ84_01470) | - | 263900..264232 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| HEQ84_RS01485 | - | 264378..264857 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| HEQ84_RS01490 | - | 265299..265670 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| HEQ84_RS01495 (HEQ84_01480) | - | 266075..266590 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| HEQ84_RS01500 (HEQ84_01485) | - | 266615..266917 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| HEQ84_RS01505 (HEQ84_01490) | - | 266929..267240 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=435349 HEQ84_RS01470 WP_002946147.1 262960..263169(+) (comA) [Streptococcus thermophilus strain CS6]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=435349 HEQ84_RS01470 WP_002946147.1 262960..263169(+) (comA) [Streptococcus thermophilus strain CS6]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |