Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S85_RS13740 | Genome accession | NZ_CP047839 |
| Coordinates | 2791710..2792180 (+) | Length | 156 a.a. |
| NCBI ID | WP_160176123.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UP_678 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2750939..2798001 | 2791710..2792180 | within | 0 |
Gene organization within MGE regions
Location: 2750939..2798001
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S85_RS13500 (E3S85_13500) | - | 2750939..2752867 (-) | 1929 | WP_000602046.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| E3S85_RS13505 (E3S85_13505) | - | 2753120..2753755 (+) | 636 | WP_001283612.1 | redox-sensing transcriptional repressor Rex | - |
| E3S85_RS13510 (E3S85_13510) | - | 2754061..2755140 (+) | 1080 | WP_000266901.1 | YeeE/YedE family protein | - |
| E3S85_RS13515 (E3S85_13515) | - | 2755200..2755424 (+) | 225 | WP_000581078.1 | sulfurtransferase TusA family protein | - |
| E3S85_RS13520 (E3S85_13520) | - | 2755633..2756883 (+) | 1251 | WP_001052261.1 | ammonium transporter | - |
| E3S85_RS13525 (E3S85_13525) | - | 2757067..2758017 (+) | 951 | WP_000790325.1 | LacI family DNA-binding transcriptional regulator | - |
| E3S85_RS13530 (E3S85_13530) | - | 2758166..2759650 (+) | 1485 | WP_001791588.1 | sucrose-6-phosphate hydrolase | - |
| E3S85_RS13535 (E3S85_13535) | - | 2759647..2760606 (+) | 960 | WP_001253292.1 | carbohydrate kinase family protein | - |
| E3S85_RS13540 (E3S85_13540) | agrA | 2760980..2761696 (-) | 717 | WP_000688492.1 | quorum-sensing response regulator AgrA | Regulator |
| E3S85_RS13545 (E3S85_13545) | agrC | 2761715..2763007 (-) | 1293 | WP_000387809.1 | quorum-sensing sensor histidine kinase AgrC | - |
| E3S85_RS13550 (E3S85_13550) | agrD | 2763032..2763172 (-) | 141 | WP_000735197.1 | cyclic lactone autoinducer peptide AgrD | - |
| E3S85_RS13555 (E3S85_13555) | - | 2763176..2763739 (-) | 564 | WP_001105709.1 | accessory gene regulator AgrB | - |
| E3S85_RS14120 | hld | 2764029..2764109 (+) | 81 | WP_000046022.1 | delta-hemolysin | - |
| E3S85_RS13565 (E3S85_13565) | - | 2764712..2765497 (-) | 786 | WP_000867948.1 | carbon-nitrogen family hydrolase | - |
| E3S85_RS13570 (E3S85_13570) | - | 2765858..2766484 (-) | 627 | WP_000522388.1 | nitroreductase family protein | - |
| E3S85_RS13575 (E3S85_13575) | - | 2766681..2767892 (+) | 1212 | WP_111138094.1 | SdrH family protein | - |
| E3S85_RS13580 (E3S85_13580) | mroQ | 2767917..2768660 (-) | 744 | WP_033844814.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| E3S85_RS13585 (E3S85_13585) | groES | 2768835..2769119 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| E3S85_RS13590 (E3S85_13590) | groL | 2769195..2770811 (+) | 1617 | WP_000240651.1 | chaperonin GroEL | - |
| E3S85_RS13595 (E3S85_13595) | - | 2771353..2771532 (+) | 180 | WP_000201397.1 | hypothetical protein | - |
| E3S85_RS13600 (E3S85_13600) | - | 2771529..2771825 (+) | 297 | WP_001573769.1 | hypothetical protein | - |
| E3S85_RS13605 (E3S85_13605) | - | 2771815..2772156 (+) | 342 | WP_001573771.1 | hypothetical protein | - |
| E3S85_RS13610 (E3S85_13610) | - | 2772734..2774041 (-) | 1308 | WP_001045073.1 | TrkH family potassium uptake protein | - |
| E3S85_RS13615 (E3S85_13615) | - | 2774480..2775703 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| E3S85_RS13620 (E3S85_13620) | - | 2776135..2777190 (+) | 1056 | WP_000791398.1 | leukocidin family pore-forming toxin | - |
| E3S85_RS13625 (E3S85_13625) | - | 2777212..2778231 (+) | 1020 | WP_000595617.1 | leukocidin/hemolysin toxin family protein | - |
| E3S85_RS13630 (E3S85_13630) | sph | 2778488..2779312 (-) | 825 | Protein_2653 | sphingomyelin phosphodiesterase | - |
| E3S85_RS13635 (E3S85_13635) | - | 2779369..2780406 (-) | 1038 | WP_160176118.1 | tyrosine-type recombinase/integrase | - |
| E3S85_RS13640 (E3S85_13640) | - | 2780579..2781118 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| E3S85_RS13645 (E3S85_13645) | - | 2781258..2781425 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| E3S85_RS14125 | - | 2781620..2782777 (-) | 1158 | WP_236650901.1 | hypothetical protein | - |
| E3S85_RS13655 (E3S85_13655) | - | 2782833..2783459 (-) | 627 | WP_160176119.1 | LexA family transcriptional regulator | - |
| E3S85_RS13660 (E3S85_13660) | - | 2783657..2783872 (+) | 216 | WP_000916582.1 | hypothetical protein | - |
| E3S85_RS13665 (E3S85_13665) | - | 2783888..2784103 (+) | 216 | WP_001025405.1 | Thoeris anti-defense Tad2 family protein | - |
| E3S85_RS13670 (E3S85_13670) | - | 2784092..2784421 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| E3S85_RS13675 (E3S85_13675) | - | 2784472..2785212 (+) | 741 | WP_160176120.1 | phage antirepressor KilAC domain-containing protein | - |
| E3S85_RS14130 | - | 2785237..2785320 (+) | 84 | Protein_2663 | hypothetical protein | - |
| E3S85_RS13680 (E3S85_13680) | - | 2785329..2785532 (-) | 204 | WP_031768726.1 | hypothetical protein | - |
| E3S85_RS13685 (E3S85_13685) | - | 2785591..2785830 (+) | 240 | WP_001294156.1 | hypothetical protein | - |
| E3S85_RS13690 (E3S85_13690) | - | 2786157..2786483 (+) | 327 | WP_160176121.1 | hypothetical protein | - |
| E3S85_RS14135 | - | 2786480..2786579 (+) | 100 | Protein_2667 | hypothetical protein | - |
| E3S85_RS13700 (E3S85_13700) | - | 2786728..2787048 (+) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| E3S85_RS13705 (E3S85_13705) | - | 2787045..2787206 (+) | 162 | WP_001619936.1 | DUF1270 family protein | - |
| E3S85_RS13710 (E3S85_13710) | - | 2787299..2787600 (+) | 302 | Protein_2670 | DUF2482 family protein | - |
| E3S85_RS13715 (E3S85_13715) | - | 2787605..2787865 (+) | 261 | WP_106889224.1 | DUF1108 family protein | - |
| E3S85_RS13720 (E3S85_13720) | - | 2787874..2788137 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| E3S85_RS13725 (E3S85_13725) | - | 2788134..2790089 (+) | 1956 | WP_201751133.1 | AAA family ATPase | - |
| E3S85_RS13730 (E3S85_13730) | - | 2790091..2791011 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| E3S85_RS13735 (E3S85_13735) | - | 2791092..2791709 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| E3S85_RS13740 (E3S85_13740) | ssbA | 2791710..2792180 (+) | 471 | WP_160176123.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S85_RS14240 (E3S85_13745) | - | 2792210..2793083 (+) | 874 | Protein_2677 | DnaD domain protein | - |
| E3S85_RS13750 (E3S85_13750) | - | 2793090..2793308 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| E3S85_RS13755 (E3S85_13755) | - | 2793317..2793721 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S85_RS13760 (E3S85_13760) | - | 2793734..2794102 (+) | 369 | WP_106884743.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S85_RS13765 (E3S85_13765) | - | 2794106..2794348 (+) | 243 | WP_000131385.1 | phi PVL orf 51-like protein | - |
| E3S85_RS13770 (E3S85_13770) | - | 2794363..2794767 (+) | 405 | WP_015978309.1 | hypothetical protein | - |
| E3S85_RS13775 (E3S85_13775) | - | 2794767..2795042 (+) | 276 | WP_000399886.1 | hypothetical protein | - |
| E3S85_RS13780 (E3S85_13780) | - | 2795035..2795283 (+) | 249 | WP_047213620.1 | DUF1024 family protein | - |
| E3S85_RS13785 (E3S85_13785) | - | 2795276..2795812 (+) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| E3S85_RS13790 (E3S85_13790) | - | 2795849..2796094 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| E3S85_RS13795 (E3S85_13795) | - | 2796091..2796297 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| E3S85_RS13800 (E3S85_13800) | - | 2796294..2796680 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| E3S85_RS13805 (E3S85_13805) | rinB | 2796677..2796826 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| E3S85_RS13810 (E3S85_13810) | - | 2796826..2797026 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| E3S85_RS13815 (E3S85_13815) | - | 2797054..2797470 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| E3S85_RS13820 (E3S85_13820) | - | 2797702..2798001 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17640.58 Da Isoelectric Point: 8.3589
>NTDB_id=417576 E3S85_RS13740 WP_160176123.1 2791710..2792180(+) (ssbA) [Staphylococcus aureus strain UP_678]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTKVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTKVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=417576 E3S85_RS13740 WP_160176123.1 2791710..2792180(+) (ssbA) [Staphylococcus aureus strain UP_678]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGAAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGAAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |