Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   GTW28_RS12580 Genome accession   NZ_CP047485
Coordinates   2443296..2443670 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain BJQ0005     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2438296..2448670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GTW28_RS12540 (GTW28_12540) yqhG 2438627..2439421 (+) 795 WP_003230200.1 YqhG family protein -
  GTW28_RS12545 (GTW28_12545) sinI 2439604..2439777 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GTW28_RS12550 (GTW28_12550) sinR 2439811..2440146 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GTW28_RS12555 (GTW28_12555) tasA 2440239..2441024 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GTW28_RS12560 (GTW28_12560) sipW 2441088..2441660 (-) 573 WP_003230181.1 signal peptidase I SipW -
  GTW28_RS12565 (GTW28_12565) tapA 2441644..2442405 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  GTW28_RS12570 (GTW28_12570) yqzG 2442677..2443003 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GTW28_RS12575 (GTW28_12575) spoIITA 2443045..2443224 (-) 180 WP_029726723.1 YqzE family protein -
  GTW28_RS12580 (GTW28_12580) comGG 2443296..2443670 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GTW28_RS12585 (GTW28_12585) comGF 2443671..2444054 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  GTW28_RS12590 (GTW28_12590) comGE 2444080..2444427 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  GTW28_RS12595 (GTW28_12595) comGD 2444411..2444842 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  GTW28_RS12600 (GTW28_12600) comGC 2444832..2445128 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  GTW28_RS12605 (GTW28_12605) comGB 2445142..2446179 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  GTW28_RS12610 (GTW28_12610) comGA 2446166..2447236 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GTW28_RS12615 (GTW28_12615) - 2447448..2447645 (-) 198 WP_014480259.1 CBS domain-containing protein -
  GTW28_RS12620 (GTW28_12620) corA 2447647..2448600 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=413684 GTW28_RS12580 WP_014480253.1 2443296..2443670(-) (comGG) [Bacillus subtilis strain BJQ0005]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=413684 GTW28_RS12580 WP_014480253.1 2443296..2443670(-) (comGG) [Bacillus subtilis strain BJQ0005]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment