Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GTW28_RS12545 Genome accession   NZ_CP047485
Coordinates   2439604..2439777 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BJQ0005     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2434604..2444777
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GTW28_RS12530 (GTW28_12530) gcvT 2435403..2436491 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  GTW28_RS12535 (GTW28_12535) hepAA 2436933..2438606 (+) 1674 WP_003230203.1 SNF2-related protein -
  GTW28_RS12540 (GTW28_12540) yqhG 2438627..2439421 (+) 795 WP_003230200.1 YqhG family protein -
  GTW28_RS12545 (GTW28_12545) sinI 2439604..2439777 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GTW28_RS12550 (GTW28_12550) sinR 2439811..2440146 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GTW28_RS12555 (GTW28_12555) tasA 2440239..2441024 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GTW28_RS12560 (GTW28_12560) sipW 2441088..2441660 (-) 573 WP_003230181.1 signal peptidase I SipW -
  GTW28_RS12565 (GTW28_12565) tapA 2441644..2442405 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  GTW28_RS12570 (GTW28_12570) yqzG 2442677..2443003 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GTW28_RS12575 (GTW28_12575) spoIITA 2443045..2443224 (-) 180 WP_029726723.1 YqzE family protein -
  GTW28_RS12580 (GTW28_12580) comGG 2443296..2443670 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GTW28_RS12585 (GTW28_12585) comGF 2443671..2444054 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  GTW28_RS12590 (GTW28_12590) comGE 2444080..2444427 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=413682 GTW28_RS12545 WP_003230187.1 2439604..2439777(+) (sinI) [Bacillus subtilis strain BJQ0005]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=413682 GTW28_RS12545 WP_003230187.1 2439604..2439777(+) (sinI) [Bacillus subtilis strain BJQ0005]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment