Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   GPY14_RS05665 Genome accession   NZ_CP046918
Coordinates   1278484..1278750 (-) Length   88 a.a.
NCBI ID   WP_050515801.1    Uniprot ID   -
Organism   Bacillus velezensis strain BA-26     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1273484..1283750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GPY14_RS05615 (GPY14_05605) sinR 1273648..1273983 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GPY14_RS05620 (GPY14_05610) tasA 1274031..1274816 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GPY14_RS05625 (GPY14_05615) sipW 1274881..1275465 (-) 585 WP_015240205.1 signal peptidase I SipW -
  GPY14_RS05630 (GPY14_05620) tapA 1275437..1276108 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  GPY14_RS05635 (GPY14_05625) - 1276367..1276696 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  GPY14_RS05640 (GPY14_05630) - 1276736..1276915 (-) 180 WP_003153093.1 YqzE family protein -
  GPY14_RS05645 (GPY14_05635) comGG 1276972..1277349 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  GPY14_RS05650 (GPY14_05640) comGF 1277350..1277850 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  GPY14_RS05655 (GPY14_05645) comGE 1277759..1278073 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  GPY14_RS05660 (GPY14_05650) comGD 1278057..1278494 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  GPY14_RS05665 (GPY14_05655) comGC 1278484..1278750 (-) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  GPY14_RS05670 (GPY14_05660) comGB 1278797..1279834 (-) 1038 WP_158185901.1 competence type IV pilus assembly protein ComGB Machinery gene
  GPY14_RS05675 (GPY14_05665) comGA 1279821..1280891 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  GPY14_RS05680 (GPY14_05670) - 1281084..1282036 (-) 953 Protein_1149 magnesium transporter CorA family protein -
  GPY14_RS05685 (GPY14_05675) - 1282105..1283484 (+) 1380 WP_158185902.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9749.37 Da        Isoelectric Point: 6.2027

>NTDB_id=409333 GPY14_RS05665 WP_050515801.1 1278484..1278750(-) (comGC) [Bacillus velezensis strain BA-26]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTVCPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=409333 GPY14_RS05665 WP_050515801.1 1278484..1278750(-) (comGC) [Bacillus velezensis strain BA-26]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGTCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

76.056

80.682

0.614

Multiple sequence alignment