Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | GL185_RS07545 | Genome accession | NZ_CP046357 |
| Coordinates | 1505533..1505658 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain 525 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1500533..1510658
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL185_RS07520 (GL185_07655) | dnaA | 1501018..1502379 (-) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
| GL185_RS07525 (GL185_07660) | spo0J | 1502592..1503350 (-) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| GL185_RS07530 (GL185_07665) | htrA | 1503408..1504589 (-) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| GL185_RS07535 (GL185_07670) | rlmH | 1504772..1505251 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GL185_RS07545 (GL185_07680) | comC/comC2 | 1505533..1505658 (+) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| GL185_RS07550 (GL185_07685) | comD/comD2 | 1505679..1507004 (+) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| GL185_RS07555 (GL185_07690) | comE | 1507001..1507753 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| GL185_RS07570 (GL185_07705) | - | 1507996..1508538 (-) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| GL185_RS11520 | - | 1508717..1510320 (+) | 1604 | Protein_1514 | YhgE/Pip domain-containing protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=403183 GL185_RS07545 WP_000799694.1 1505533..1505658(+) (comC/comC2) [Streptococcus pneumoniae strain 525]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=403183 GL185_RS07545 WP_000799694.1 1505533..1505658(+) (comC/comC2) [Streptococcus pneumoniae strain 525]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |