Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | GFU50_RS06445 | Genome accession | NZ_CP046123 |
| Coordinates | 1359706..1360176 (+) | Length | 156 a.a. |
| NCBI ID | WP_154694346.1 | Uniprot ID | - |
| Organism | Enterococcus casseliflavus strain EC291 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1348219..1393115 | 1359706..1360176 | within | 0 |
Gene organization within MGE regions
Location: 1348219..1393115
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GFU50_RS06340 (GFU50_06340) | - | 1348219..1348641 (-) | 423 | WP_154694331.1 | HIT family protein | - |
| GFU50_RS06345 (GFU50_06345) | - | 1349109..1350242 (-) | 1134 | WP_194186001.1 | tyrosine-type recombinase/integrase | - |
| GFU50_RS06350 (GFU50_06350) | - | 1350341..1350754 (-) | 414 | WP_034872770.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GFU50_RS06355 (GFU50_06355) | - | 1350765..1351097 (-) | 333 | WP_194186000.1 | helix-turn-helix domain-containing protein | - |
| GFU50_RS06360 (GFU50_06360) | - | 1351336..1351542 (+) | 207 | WP_412059277.1 | helix-turn-helix domain-containing protein | - |
| GFU50_RS06365 (GFU50_06365) | - | 1351555..1351875 (+) | 321 | WP_144770898.1 | DUF771 domain-containing protein | - |
| GFU50_RS06370 (GFU50_06370) | - | 1351999..1352232 (-) | 234 | WP_154694335.1 | hypothetical protein | - |
| GFU50_RS06375 (GFU50_06375) | - | 1352308..1353057 (+) | 750 | WP_154694336.1 | phage antirepressor KilAC domain-containing protein | - |
| GFU50_RS06380 (GFU50_06380) | - | 1353137..1353685 (-) | 549 | WP_121262166.1 | hypothetical protein | - |
| GFU50_RS06385 (GFU50_06385) | - | 1353819..1354295 (-) | 477 | WP_154694337.1 | hypothetical protein | - |
| GFU50_RS06390 (GFU50_06390) | - | 1354342..1354623 (+) | 282 | WP_154694338.1 | hypothetical protein | - |
| GFU50_RS19030 | - | 1354799..1354921 (+) | 123 | WP_268259971.1 | hypothetical protein | - |
| GFU50_RS06395 (GFU50_06395) | - | 1354922..1355182 (+) | 261 | WP_154694339.1 | hypothetical protein | - |
| GFU50_RS06400 (GFU50_06400) | - | 1355269..1355604 (+) | 336 | WP_154694340.1 | hypothetical protein | - |
| GFU50_RS06405 (GFU50_06405) | - | 1355601..1356245 (+) | 645 | WP_154694341.1 | ERF family protein | - |
| GFU50_RS06410 (GFU50_06410) | - | 1356251..1356928 (+) | 678 | WP_154694342.1 | putative HNHc nuclease | - |
| GFU50_RS06415 (GFU50_06415) | - | 1356948..1357721 (+) | 774 | WP_195907765.1 | DnaD domain-containing protein | - |
| GFU50_RS06420 (GFU50_06420) | - | 1357726..1358562 (+) | 837 | WP_142962877.1 | ATP-binding protein | - |
| GFU50_RS06425 (GFU50_06425) | - | 1358565..1358765 (+) | 201 | WP_154694344.1 | hypothetical protein | - |
| GFU50_RS06430 (GFU50_06430) | - | 1358755..1359168 (+) | 414 | WP_142962879.1 | hypothetical protein | - |
| GFU50_RS06435 (GFU50_06435) | - | 1359132..1359533 (+) | 402 | WP_230209443.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GFU50_RS06440 (GFU50_06440) | - | 1359530..1359709 (+) | 180 | WP_154694345.1 | hypothetical protein | - |
| GFU50_RS06445 (GFU50_06445) | ssbA | 1359706..1360176 (+) | 471 | WP_154694346.1 | single-stranded DNA-binding protein | Machinery gene |
| GFU50_RS18590 | - | 1360350..1360511 (+) | 162 | WP_195907756.1 | hypothetical protein | - |
| GFU50_RS06450 (GFU50_06450) | - | 1360489..1361088 (+) | 600 | WP_154694347.1 | DUF1642 domain-containing protein | - |
| GFU50_RS06455 (GFU50_06455) | - | 1361092..1361325 (+) | 234 | WP_154694348.1 | hypothetical protein | - |
| GFU50_RS06460 (GFU50_06460) | - | 1361325..1361636 (+) | 312 | WP_230209444.1 | hypothetical protein | - |
| GFU50_RS06465 (GFU50_06465) | - | 1361669..1362253 (+) | 585 | WP_230209445.1 | hypothetical protein | - |
| GFU50_RS06470 (GFU50_06470) | - | 1362291..1362686 (+) | 396 | WP_154694350.1 | hypothetical protein | - |
| GFU50_RS06475 (GFU50_06475) | - | 1362686..1363054 (+) | 369 | WP_230209446.1 | hypothetical protein | - |
| GFU50_RS06480 (GFU50_06480) | - | 1363339..1363596 (+) | 258 | WP_154694351.1 | hypothetical protein | - |
| GFU50_RS06485 (GFU50_06485) | - | 1363586..1363777 (+) | 192 | WP_154694352.1 | hypothetical protein | - |
| GFU50_RS06490 (GFU50_06490) | - | 1363780..1363974 (+) | 195 | WP_154694353.1 | hypothetical protein | - |
| GFU50_RS06495 (GFU50_06495) | - | 1363971..1364264 (+) | 294 | WP_230209447.1 | hypothetical protein | - |
| GFU50_RS06500 (GFU50_06500) | - | 1364265..1364678 (+) | 414 | WP_113849809.1 | hypothetical protein | - |
| GFU50_RS06505 (GFU50_06505) | - | 1365524..1366720 (+) | 1197 | WP_154694354.1 | helix-turn-helix domain-containing protein | - |
| GFU50_RS06510 (GFU50_06510) | - | 1367208..1367687 (+) | 480 | WP_154694355.1 | terminase small subunit | - |
| GFU50_RS06515 (GFU50_06515) | - | 1367680..1369002 (+) | 1323 | WP_154694356.1 | PBSX family phage terminase large subunit | - |
| GFU50_RS06520 (GFU50_06520) | - | 1369016..1370434 (+) | 1419 | WP_154694357.1 | phage portal protein | - |
| GFU50_RS06525 (GFU50_06525) | - | 1370424..1370729 (+) | 306 | WP_154694358.1 | hypothetical protein | - |
| GFU50_RS06530 (GFU50_06530) | - | 1370742..1371890 (+) | 1149 | WP_154694359.1 | minor capsid protein | - |
| GFU50_RS06535 (GFU50_06535) | - | 1371992..1372642 (+) | 651 | WP_228074064.1 | DUF4355 domain-containing protein | - |
| GFU50_RS06540 (GFU50_06540) | - | 1372658..1373692 (+) | 1035 | WP_154694361.1 | major capsid protein | - |
| GFU50_RS06545 (GFU50_06545) | - | 1373704..1374030 (+) | 327 | WP_154694362.1 | phage head-tail connector protein | - |
| GFU50_RS06550 (GFU50_06550) | - | 1374011..1374361 (+) | 351 | WP_154694363.1 | hypothetical protein | - |
| GFU50_RS06555 (GFU50_06555) | - | 1374351..1374893 (+) | 543 | WP_154694364.1 | HK97 gp10 family phage protein | - |
| GFU50_RS06560 (GFU50_06560) | - | 1374893..1375255 (+) | 363 | WP_154694365.1 | hypothetical protein | - |
| GFU50_RS06565 (GFU50_06565) | - | 1375268..1375690 (+) | 423 | WP_086317165.1 | phage tail protein | - |
| GFU50_RS06570 (GFU50_06570) | - | 1375786..1376193 (+) | 408 | WP_154694366.1 | DUF6096 family protein | - |
| GFU50_RS06575 (GFU50_06575) | - | 1376217..1376591 (+) | 375 | WP_154694367.1 | hypothetical protein | - |
| GFU50_RS06580 (GFU50_06580) | - | 1376602..1381509 (+) | 4908 | WP_154694368.1 | phage tail protein | - |
| GFU50_RS06585 (GFU50_06585) | - | 1381523..1381879 (+) | 357 | WP_010749498.1 | DUF6711 family protein | - |
| GFU50_RS06590 (GFU50_06590) | - | 1381891..1385937 (+) | 4047 | WP_154694369.1 | hypothetical protein | - |
| GFU50_RS06595 (GFU50_06595) | - | 1385948..1386370 (+) | 423 | WP_195907757.1 | DUF1617 family protein | - |
| GFU50_RS06600 (GFU50_06600) | - | 1386413..1386661 (+) | 249 | WP_154694370.1 | hypothetical protein | - |
| GFU50_RS06605 (GFU50_06605) | - | 1386696..1386989 (+) | 294 | WP_010749285.1 | hypothetical protein | - |
| GFU50_RS06610 (GFU50_06610) | - | 1386991..1387236 (+) | 246 | WP_010749286.1 | phage holin | - |
| GFU50_RS06615 (GFU50_06615) | - | 1387275..1388054 (+) | 780 | WP_154694371.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| GFU50_RS06620 (GFU50_06620) | - | 1388773..1389210 (+) | 438 | WP_230209448.1 | Panacea domain-containing protein | - |
| GFU50_RS06625 (GFU50_06625) | - | 1389214..1389651 (+) | 438 | WP_154694372.1 | hypothetical protein | - |
| GFU50_RS06630 (GFU50_06630) | - | 1389714..1390352 (-) | 639 | WP_154694373.1 | hypothetical protein | - |
| GFU50_RS06635 (GFU50_06635) | - | 1390484..1390777 (-) | 294 | WP_154694374.1 | hypothetical protein | - |
| GFU50_RS06640 (GFU50_06640) | - | 1390668..1390967 (-) | 300 | WP_195907758.1 | hypothetical protein | - |
| GFU50_RS06645 (GFU50_06645) | - | 1390939..1391229 (-) | 291 | WP_154694376.1 | DUF5960 family protein | - |
| GFU50_RS06650 (GFU50_06650) | - | 1391382..1391999 (-) | 618 | WP_154694377.1 | DUF4352 domain-containing protein | - |
| GFU50_RS06660 (GFU50_06660) | - | 1392417..1393115 (-) | 699 | WP_005225745.1 | O-methyltransferase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17188.85 Da Isoelectric Point: 5.1932
>NTDB_id=401262 GFU50_RS06445 WP_154694346.1 1359706..1360176(+) (ssbA) [Enterococcus casseliflavus strain EC291]
MINNVVLVGRLTKDPDLKYTGSGTAVATFTLAVNRNFTNQSGEREADFINCVIWRKPAETLANYAKKGVLIGVTGRIQTR
SYDNQQGQKVYVTEVIADNFQLLESKKADSSQNTQGSGVSNSQTNNYARNQQNRNNDESDPFGNSSIDISDDSLPF
MINNVVLVGRLTKDPDLKYTGSGTAVATFTLAVNRNFTNQSGEREADFINCVIWRKPAETLANYAKKGVLIGVTGRIQTR
SYDNQQGQKVYVTEVIADNFQLLESKKADSSQNTQGSGVSNSQTNNYARNQQNRNNDESDPFGNSSIDISDDSLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=401262 GFU50_RS06445 WP_154694346.1 1359706..1360176(+) (ssbA) [Enterococcus casseliflavus strain EC291]
ATGATAAACAACGTTGTACTTGTCGGAAGACTGACGAAAGATCCAGATTTGAAATATACAGGTAGCGGAACCGCAGTTGC
CACCTTCACATTAGCTGTGAATCGCAACTTCACGAATCAGAGCGGAGAGCGAGAAGCGGACTTCATCAATTGTGTTATTT
GGAGAAAGCCAGCTGAAACATTAGCGAACTATGCGAAAAAAGGCGTGTTGATCGGAGTAACGGGGCGGATTCAAACTCGT
TCTTACGATAACCAACAAGGACAAAAAGTTTATGTCACCGAAGTGATTGCGGACAACTTCCAGTTGTTAGAAAGCAAGAA
AGCCGATTCTAGCCAAAATACACAAGGTAGCGGCGTTTCAAATAGTCAAACGAATAATTACGCTCGCAACCAACAAAACC
GCAACAACGATGAATCAGACCCATTTGGTAACTCGTCGATTGATATCAGTGATGATAGCCTTCCGTTTTGA
ATGATAAACAACGTTGTACTTGTCGGAAGACTGACGAAAGATCCAGATTTGAAATATACAGGTAGCGGAACCGCAGTTGC
CACCTTCACATTAGCTGTGAATCGCAACTTCACGAATCAGAGCGGAGAGCGAGAAGCGGACTTCATCAATTGTGTTATTT
GGAGAAAGCCAGCTGAAACATTAGCGAACTATGCGAAAAAAGGCGTGTTGATCGGAGTAACGGGGCGGATTCAAACTCGT
TCTTACGATAACCAACAAGGACAAAAAGTTTATGTCACCGAAGTGATTGCGGACAACTTCCAGTTGTTAGAAAGCAAGAA
AGCCGATTCTAGCCAAAATACACAAGGTAGCGGCGTTTCAAATAGTCAAACGAATAATTACGCTCGCAACCAACAAAACC
GCAACAACGATGAATCAGACCCATTTGGTAACTCGTCGATTGATATCAGTGATGATAGCCTTCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.046 |
100 |
0.647 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.14 |
100 |
0.641 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.292 |
72.436 |
0.429 |
| ssbA | Streptococcus mutans UA159 |
37.179 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
53.774 |
67.949 |
0.365 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.718 |
75 |
0.365 |