Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   GII87_RS13905 Genome accession   NZ_CP045922
Coordinates   2651972..2652382 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain P8_B1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647338..2698828 2651972..2652382 within 0


Gene organization within MGE regions


Location: 2647338..2698828
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII87_RS13880 (GII87_13880) yqeF 2647505..2648236 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  GII87_RS13885 (GII87_13885) cwlH 2648488..2649240 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  GII87_RS13890 (GII87_13890) yqeD 2649427..2650053 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  GII87_RS13895 (GII87_13895) gnd 2650072..2650965 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  GII87_RS13900 (GII87_13900) yqeB 2651217..2651939 (+) 723 WP_010886572.1 hypothetical protein -
  GII87_RS13905 (GII87_13905) nucA/comI 2651972..2652382 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  GII87_RS13910 (GII87_13910) - 2652578..2652925 (+) 348 Protein_2700 sigma-70 family RNA polymerase sigma factor -
  GII87_RS13915 (GII87_13915) spoIVCA 2652956..2654416 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  GII87_RS22725 - 2654374..2654552 (-) 179 Protein_2702 hypothetical protein -
  GII87_RS13920 (GII87_13920) arsC 2654907..2655326 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  GII87_RS13925 (GII87_13925) acr3 2655338..2656378 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  GII87_RS13930 (GII87_13930) arsK 2656401..2656841 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  GII87_RS13935 (GII87_13935) arsR 2656902..2657219 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  GII87_RS13940 (GII87_13940) yqcI 2657591..2658355 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  GII87_RS13945 (GII87_13945) rapE 2658798..2659925 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  GII87_RS13950 (GII87_13950) phrE 2659915..2660049 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  GII87_RS13955 (GII87_13955) - 2660159..2660317 (+) 159 WP_003245945.1 hypothetical protein -
  GII87_RS13960 (GII87_13960) yqcG 2660687..2662282 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  GII87_RS13965 (GII87_13965) yqcF 2662297..2662875 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  GII87_RS13970 (GII87_13970) - 2662993..2663139 (+) 147 WP_009967791.1 hypothetical protein -
  GII87_RS13975 (GII87_13975) - 2663136..2663498 (-) 363 WP_003229947.1 hypothetical protein -
  GII87_RS13980 (GII87_13980) - 2663514..2663993 (-) 480 WP_004399085.1 hypothetical protein -
  GII87_RS13985 (GII87_13985) cwlA 2664158..2664976 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  GII87_RS13990 (GII87_13990) skhD 2665021..2665443 (-) 423 WP_003246208.1 holin family protein -
  GII87_RS13995 (GII87_13995) xepAK 2665488..2666381 (-) 894 WP_003246010.1 hypothetical protein -
  GII87_RS14000 (GII87_14000) yqcE 2666469..2666633 (-) 165 WP_003229944.1 XkdX family protein -
  GII87_RS14005 (GII87_14005) yqcD 2666630..2666965 (-) 336 WP_009967793.1 XkdW family protein -
  GII87_RS14010 (GII87_14010) yqcC 2666975..2668075 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  GII87_RS14015 (GII87_14015) - 2668078..2668350 (-) 273 WP_003229942.1 hypothetical protein -
  GII87_RS14020 (GII87_14020) yqcA 2668347..2668925 (-) 579 WP_003229941.1 YmfQ family protein -
  GII87_RS14025 (GII87_14025) yqbT 2668909..2669955 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  GII87_RS14030 (GII87_14030) yqbS 2669948..2670373 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  GII87_RS14035 (GII87_14035) yqbR 2670386..2670649 (-) 264 WP_003229938.1 DUF2577 family protein -
  GII87_RS14040 (GII87_14040) yqbQ 2670646..2671626 (-) 981 WP_004398524.1 hypothetical protein -
  GII87_RS14045 (GII87_14045) yqbP 2671639..2672298 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  GII87_RS14050 (GII87_14050) yqbO 2672291..2677048 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  GII87_RS14055 (GII87_14055) - 2677051..2677188 (-) 138 WP_003229934.1 hypothetical protein -
  GII87_RS14060 (GII87_14060) - 2677230..2677679 (-) 450 WP_003229933.1 phage portal protein -
  GII87_RS14065 (GII87_14065) txpA 2677825..2678004 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  GII87_RS14070 (GII87_14070) bsrH 2678384..2678473 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  GII87_RS14075 (GII87_14075) yqbM 2678727..2679170 (-) 444 WP_003229930.1 phage tail tube protein -
  GII87_RS14080 (GII87_14080) yqbK 2679173..2680573 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  GII87_RS14085 (GII87_14085) - 2680574..2680765 (-) 192 WP_010886574.1 hypothetical protein -
  GII87_RS14090 (GII87_14090) yqbJ 2680762..2681199 (-) 438 WP_003229927.1 DUF6838 family protein -
  GII87_RS14095 (GII87_14095) yqbI 2681212..2681715 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  GII87_RS14100 (GII87_14100) yqbH 2681712..2682074 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  GII87_RS14105 (GII87_14105) gkpG 2682071..2682466 (-) 396 WP_004398566.1 DUF3199 family protein -
  GII87_RS14110 (GII87_14110) yqbF 2682470..2682781 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  GII87_RS14115 (GII87_14115) skdG 2682792..2683727 (-) 936 WP_003229922.1 phage major capsid protein -
  GII87_RS14120 (GII87_14120) yqbD 2683746..2684714 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  GII87_RS14125 (GII87_14125) - 2684747..2685400 (-) 654 WP_003229920.1 hypothetical protein -
  GII87_RS14130 (GII87_14130) yqbB 2685441..2686358 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  GII87_RS14135 (GII87_14135) yqbA 2686355..2687887 (-) 1533 WP_004398894.1 phage portal protein -
  GII87_RS14140 (GII87_14140) stmB 2687891..2689186 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  GII87_RS14145 (GII87_14145) terS 2689179..2689898 (-) 720 WP_003229916.1 phage terminase small subunit -
  GII87_RS14150 (GII87_14150) - 2689966..2690430 (-) 465 WP_004398685.1 hypothetical protein -
  GII87_RS14155 (GII87_14155) yqaQ 2690574..2691029 (-) 456 WP_004398775.1 hypothetical protein -
  GII87_RS14160 (GII87_14160) - 2691227..2692156 (+) 930 WP_003229913.1 hypothetical protein -
  GII87_RS14165 (GII87_14165) yqaO 2692230..2692436 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  GII87_RS14170 (GII87_14170) yqaN 2692518..2692946 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  GII87_RS14175 (GII87_14175) - 2693042..2693191 (-) 150 WP_003229910.1 hypothetical protein -
  GII87_RS14180 (GII87_14180) sknM 2693182..2694123 (-) 942 WP_075058863.1 ATP-binding protein -
  GII87_RS14185 (GII87_14185) yqaL 2694005..2694682 (-) 678 WP_010886575.1 DnaD domain protein -
  GII87_RS14190 (GII87_14190) recT 2694758..2695612 (-) 855 WP_003229907.1 recombinase RecT -
  GII87_RS14195 (GII87_14195) yqaJ 2695615..2696574 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  GII87_RS14200 (GII87_14200) - 2696680..2696874 (-) 195 WP_003229905.1 hypothetical protein -
  GII87_RS14205 (GII87_14205) - 2696834..2697007 (-) 174 WP_119123069.1 hypothetical protein -
  GII87_RS14210 (GII87_14210) sknH 2697004..2697261 (-) 258 WP_003245994.1 YqaH family protein -
  GII87_RS14215 (GII87_14215) yqaG 2697258..2697827 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  GII87_RS14220 (GII87_14220) - 2697901..2698041 (-) 141 WP_003229902.1 hypothetical protein -
  GII87_RS14225 (GII87_14225) yqaF 2698071..2698301 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  GII87_RS14230 (GII87_14230) sknR 2698478..2698828 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=399138 GII87_RS13905 WP_009967785.1 2651972..2652382(-) (nucA/comI) [Bacillus subtilis strain P8_B1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=399138 GII87_RS13905 WP_009967785.1 2651972..2652382(-) (nucA/comI) [Bacillus subtilis strain P8_B1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment