NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	HJD23_RS40105	Genome accession	NZ_CP053109
Coordinates	8781700..8782302 (-)	Length	200 a.a.
NCBI ID	WP_171110479.1	Uniprot ID	-
Organism	Streptomyces sp. Z423-1
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 8776700..8787302

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HJD23_RS40075	-	8776900..8777277 (-)	378	WP_171110475.1	metalloregulator ArsR/SmtB family transcription factor	-
HJD23_RS40080	-	8777447..8778814 (+)	1368	WP_171111767.1	NAD(P)-binding domain-containing protein	-
HJD23_RS40085	-	8778843..8779247 (+)	405	WP_171110476.1	ArsI/CadI family heavy metal resistance metalloenzyme	-
HJD23_RS44495	-	8779260..8779482 (+)	223	Protein_8040	hypothetical protein	-
HJD23_RS40090	-	8779679..8780134 (+)	456	WP_171110477.1	ATP-binding protein	-
HJD23_RS40095	-	8780175..8781062 (-)	888	WP_171111769.1	RNA polymerase sigma factor SigF	-
HJD23_RS40100	-	8781289..8781684 (+)	396	WP_171110478.1	helix-turn-helix transcriptional regulator	-
HJD23_RS40105	clpP	8781700..8782302 (-)	603	WP_171110479.1	ATP-dependent Clp protease proteolytic subunit	Regulator
HJD23_RS40110	clpP	8782305..8782964 (-)	660	WP_171110480.1	ATP-dependent Clp protease proteolytic subunit	Regulator
HJD23_RS40115	-	8783086..8784297 (-)	1212	WP_171110481.1	epoxide hydrolase family protein	-
HJD23_RS40120	-	8784420..8784902 (+)	483	WP_171110482.1	VOC family protein	-
HJD23_RS40125	-	8785373..8786275 (-)	903	WP_171110483.1	SGNH/GDSL hydrolase family protein	-

Sequence

Protein

Download Length: 200 a.a. Molecular weight: 21725.78 Da Isoelectric Point: 5.6197

                                >NTDB_id=390180 HJD23_RS40105 WP_171110479.1 8781700..8782302(-) (clpP) [Streptomyces sp. Z423-1]

MGTYTIPNVVERTPQGERSYDVFSRLLSERIIFLGTEIDDGVANVVIAQLLHLESAAPENEIAIYLNSPGGSFTSLMAIY

DTMTFVQAPISTFCVGQAASTAAVLLAGGDPGRRFVLEHARVLLGQPASGGRQGTVSDLALQAKEMVRIRSQVEEVLARH

THHDIATLRADMDRDKVFTAREAVAYGLADEVLSRRLVKV

Nucleotide

Download Length: 603 bp

                                >NTDB_id=390180 HJD23_RS40105 WP_171110479.1 8781700..8782302(-) (clpP) [Streptomyces sp. Z423-1]

ATGGGGACGTACACGATTCCGAACGTGGTCGAGCGCACCCCGCAGGGCGAGCGGTCGTACGACGTGTTCAGCCGGCTGCT

GTCGGAGCGGATCATCTTCCTCGGCACCGAGATCGACGACGGCGTGGCCAACGTCGTCATCGCCCAACTGCTGCATCTGG

AGTCGGCGGCGCCGGAGAACGAGATCGCGATCTATCTCAACTCCCCCGGCGGATCGTTCACCTCTCTGATGGCGATCTAC

GACACGATGACGTTCGTGCAGGCGCCGATCTCGACGTTCTGCGTCGGGCAGGCGGCGTCGACGGCGGCCGTGCTGCTGGC

CGGCGGGGATCCGGGGCGGCGGTTCGTGCTGGAGCACGCGCGCGTGCTGCTGGGGCAGCCCGCCAGCGGCGGGCGGCAGG

GCACGGTCTCCGATCTCGCCCTGCAGGCCAAGGAGATGGTGCGGATCCGCTCCCAGGTCGAGGAGGTGCTGGCCCGGCAC

ACCCACCACGACATCGCGACCCTGCGCGCCGACATGGACCGCGACAAGGTGTTCACCGCGCGGGAGGCGGTGGCGTACGG

GCTGGCCGACGAGGTGCTGAGCCGGCGCCTCGTGAAGGTCTGA

Domains

Predicted by InterProScan.

Clp protease (CLP_protease)

(15-195)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	47.619	94.5	0.45
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	45.263	95	0.43
clpP	Streptococcus pyogenes JRS4	39.487	97.5	0.385
clpP	Streptococcus pyogenes MGAS315	39.487	97.5	0.385
clpP	Streptococcus mutans UA159	38.462	97.5	0.375
clpP	Lactococcus lactis subsp. cremoris KW2	38.071	98.5	0.375
clpP	Streptococcus pneumoniae TIGR4	39.062	96	0.375
clpP	Streptococcus pneumoniae Rx1	39.062	96	0.375
clpP	Streptococcus pneumoniae D39	39.062	96	0.375
clpP	Streptococcus pneumoniae R6	39.062	96	0.375
clpP	Streptococcus thermophilus LMG 18311	37.949	97.5	0.37
clpP	Streptococcus thermophilus LMD-9	37.949	97.5	0.37

Detailed information NTG0390180