Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FOB68_RS04190 | Genome accession | NZ_CP044106 |
| Coordinates | 772761..773231 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610649.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FDAARGOS_660 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 748130..803138 | 772761..773231 | within | 0 |
Gene organization within MGE regions
Location: 748130..803138
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB68_RS04090 (FOB68_04095) | ebh | 748130..761587 (+) | 13458 | Protein_721 | hyperosmolarity resistance protein Ebh | - |
| FOB68_RS04095 (FOB68_04100) | - | 761649..762686 (-) | 1038 | WP_000857185.1 | tyrosine-type recombinase/integrase | - |
| FOB68_RS04100 (FOB68_04105) | - | 762859..763398 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FOB68_RS04105 (FOB68_04110) | - | 763538..763705 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| FOB68_RS04110 (FOB68_04115) | - | 763905..764090 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| FOB68_RS14505 | - | 764077..764232 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| FOB68_RS04115 (FOB68_04120) | - | 764244..764951 (-) | 708 | WP_000094092.1 | helix-turn-helix domain-containing protein | - |
| FOB68_RS04120 (FOB68_04125) | - | 765122..765361 (+) | 240 | WP_000548578.1 | helix-turn-helix transcriptional regulator | - |
| FOB68_RS04125 (FOB68_04130) | - | 765374..765634 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| FOB68_RS04130 (FOB68_04135) | - | 765658..766197 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| FOB68_RS04135 (FOB68_04140) | - | 766254..767006 (+) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| FOB68_RS04140 (FOB68_04145) | - | 767023..767217 (+) | 195 | WP_000388066.1 | hypothetical protein | - |
| FOB68_RS04145 (FOB68_04150) | - | 767248..767388 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| FOB68_RS04150 (FOB68_04155) | - | 767403..768035 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| FOB68_RS04155 (FOB68_04160) | - | 768094..768414 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| FOB68_RS04160 (FOB68_04165) | - | 768411..768572 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| FOB68_RS04165 (FOB68_04170) | - | 768665..768925 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| FOB68_RS04170 (FOB68_04175) | - | 768934..769197 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| FOB68_RS04175 (FOB68_04180) | - | 769206..771149 (+) | 1944 | WP_000700562.1 | AAA family ATPase | - |
| FOB68_RS04180 (FOB68_04185) | - | 771151..772071 (+) | 921 | WP_031764964.1 | recombinase RecT | - |
| FOB68_RS04185 (FOB68_04190) | - | 772152..772760 (+) | 609 | WP_078090917.1 | MBL fold metallo-hydrolase | - |
| FOB68_RS04190 (FOB68_04195) | ssbA | 772761..773231 (+) | 471 | WP_000610649.1 | single-stranded DNA-binding protein | Machinery gene |
| FOB68_RS04195 (FOB68_04200) | - | 773261..774145 (+) | 885 | WP_000148302.1 | DnaD domain protein | - |
| FOB68_RS04200 (FOB68_04205) | - | 774152..774370 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| FOB68_RS04205 (FOB68_04210) | - | 774379..774783 (+) | 405 | WP_000401963.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FOB68_RS04210 (FOB68_04215) | - | 774796..775164 (+) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| FOB68_RS04215 (FOB68_04220) | - | 775168..775410 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| FOB68_RS04220 (FOB68_04225) | - | 775425..775676 (+) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| FOB68_RS14510 | - | 775666..775839 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| FOB68_RS14515 | - | 776123..776284 (+) | 162 | WP_000889682.1 | hypothetical protein | - |
| FOB68_RS04230 (FOB68_04235) | - | 776299..776832 (+) | 534 | WP_001061844.1 | dUTP diphosphatase | - |
| FOB68_RS04235 (FOB68_04240) | - | 776869..777075 (+) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| FOB68_RS04240 (FOB68_04245) | rinB | 777072..777221 (+) | 150 | WP_000595267.1 | transcriptional activator RinB | - |
| FOB68_RS14595 | - | 777380..777796 (+) | 417 | WP_001005263.1 | hypothetical protein | - |
| FOB68_RS04250 (FOB68_04255) | - | 778029..778229 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| FOB68_RS04255 (FOB68_04260) | - | 778257..778673 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| FOB68_RS04260 (FOB68_04265) | - | 778905..779204 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| FOB68_RS04265 (FOB68_04270) | - | 779335..779679 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| FOB68_RS04270 (FOB68_04275) | - | 779676..781337 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| FOB68_RS04275 (FOB68_04280) | - | 781353..782540 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| FOB68_RS04280 (FOB68_04285) | - | 782524..783261 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| FOB68_RS04285 (FOB68_04290) | - | 783285..784430 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| FOB68_RS04290 (FOB68_04295) | - | 784450..784734 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| FOB68_RS04295 (FOB68_04300) | - | 784724..785008 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| FOB68_RS04300 (FOB68_04305) | - | 784992..785354 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| FOB68_RS04305 (FOB68_04310) | - | 785351..785755 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| FOB68_RS04310 (FOB68_04315) | - | 785752..786159 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| FOB68_RS04315 (FOB68_04320) | - | 786160..786804 (+) | 645 | WP_000268741.1 | major tail protein | - |
| FOB68_RS04320 (FOB68_04325) | - | 786858..787070 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| FOB68_RS04325 (FOB68_04330) | gpG | 787120..787470 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| FOB68_RS14675 | gpGT | 787521..787658 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| FOB68_RS04330 (FOB68_04335) | - | 787715..792226 (+) | 4512 | WP_000504552.1 | phage tail tape measure protein | - |
| FOB68_RS04335 (FOB68_04340) | - | 792223..793707 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| FOB68_RS04340 (FOB68_04345) | - | 793723..797508 (+) | 3786 | WP_000582158.1 | phage tail spike protein | - |
| FOB68_RS04345 (FOB68_04350) | - | 797498..797650 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| FOB68_RS04350 (FOB68_04355) | - | 797697..797984 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| FOB68_RS04355 (FOB68_04360) | - | 798042..798338 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| FOB68_RS04360 (FOB68_04365) | pepG1 | 798530..798664 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| FOB68_RS04365 (FOB68_04370) | - | 798717..798824 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| FOB68_RS04370 (FOB68_04375) | - | 798876..799130 (+) | 255 | WP_000611512.1 | phage holin | - |
| FOB68_RS04375 (FOB68_04380) | - | 799142..799897 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| FOB68_RS04380 (FOB68_04385) | sak | 800088..800579 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| FOB68_RS04390 (FOB68_04395) | - | 801226..801564 (+) | 339 | Protein_783 | SH3 domain-containing protein | - |
| FOB68_RS04395 (FOB68_04400) | - | 801659..802108 (-) | 450 | WP_000727651.1 | chemotaxis-inhibiting protein CHIPS | - |
| FOB68_RS04400 (FOB68_04405) | scn | 802788..803138 (+) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17716.59 Da Isoelectric Point: 4.9816
>NTDB_id=387923 FOB68_RS04190 WP_000610649.1 772761..773231(+) (ssbA) [Staphylococcus aureus strain FDAARGOS_660]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=387923 FOB68_RS04190 WP_000610649.1 772761..773231(+) (ssbA) [Staphylococcus aureus strain FDAARGOS_660]
ATGATAAATAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAATAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.583 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
33.14 |
100 |
0.365 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |