Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BATR1942_RS10090 Genome accession   NC_014639
Coordinates   2076973..2077347 (-) Length   124 a.a.
NCBI ID   WP_003325434.1    Uniprot ID   -
Organism   Bacillus atrophaeus 1942     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2071973..2082347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BATR1942_RS10050 (BATR1942_10610) - 2072270..2073064 (+) 795 WP_003325443.1 YqhG family protein -
  BATR1942_RS10055 (BATR1942_10615) sinI 2073255..2073428 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  BATR1942_RS10060 (BATR1942_10620) sinR 2073462..2073797 (+) 336 WP_003325441.1 transcriptional regulator SinR Regulator
  BATR1942_RS10065 (BATR1942_10625) tasA 2073989..2074771 (-) 783 WP_003325439.1 biofilm matrix protein TasA -
  BATR1942_RS10070 (BATR1942_10630) sipW 2074835..2075407 (-) 573 WP_010789195.1 signal peptidase I SipW -
  BATR1942_RS10075 (BATR1942_10635) tapA 2075391..2076092 (-) 702 WP_003325437.1 amyloid fiber anchoring/assembly protein TapA -
  BATR1942_RS10080 (BATR1942_10640) - 2076354..2076677 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  BATR1942_RS10085 (BATR1942_10645) - 2076724..2076903 (-) 180 WP_003325435.1 YqzE family protein -
  BATR1942_RS10090 (BATR1942_10650) comGG 2076973..2077347 (-) 375 WP_003325434.1 competence type IV pilus minor pilin ComGG Machinery gene
  BATR1942_RS10095 (BATR1942_10655) comGF 2077348..2077743 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  BATR1942_RS10100 (BATR1942_10660) comGE 2077757..2078104 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene
  BATR1942_RS10105 (BATR1942_10665) comGD 2078088..2078528 (-) 441 WP_003325431.1 competence type IV pilus minor pilin ComGD Machinery gene
  BATR1942_RS10110 (BATR1942_10670) comGC 2078518..2078784 (-) 267 WP_047937532.1 competence type IV pilus major pilin ComGC Machinery gene
  BATR1942_RS10115 (BATR1942_10675) comGB 2078832..2079869 (-) 1038 WP_003325428.1 competence type IV pilus assembly protein ComGB Machinery gene
  BATR1942_RS10120 (BATR1942_10680) comGA 2079856..2080926 (-) 1071 WP_003325427.1 competence type IV pilus ATPase ComGA Machinery gene
  BATR1942_RS10125 (BATR1942_10685) - 2081343..2082296 (-) 954 WP_003325425.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14348.51 Da        Isoelectric Point: 10.0971

>NTDB_id=38773 BATR1942_RS10090 WP_003325434.1 2076973..2077347(-) (comGG) [Bacillus atrophaeus 1942]
MSRSKGFIYPAVLFAAAVILLVVGYTSSEYITRKTFEKETKEFYIRENLLQNGALLSIRHMLEARQGQKGSRQFEYGLVS
YQIQSTSKKEQKEINVKSVTNSGSEMTARFIFDLKQKKVIHWEE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=38773 BATR1942_RS10090 WP_003325434.1 2076973..2077347(-) (comGG) [Bacillus atrophaeus 1942]
ATGTCACGGTCGAAAGGCTTTATTTATCCTGCTGTGCTTTTTGCAGCAGCTGTTATTTTGCTCGTTGTCGGTTATACATC
GTCGGAATATATCACCCGTAAAACATTTGAAAAGGAGACCAAAGAATTTTACATCAGGGAAAATTTACTGCAAAATGGCG
CACTTCTGTCCATTCGTCATATGCTTGAGGCCCGTCAAGGACAAAAAGGCTCACGGCAATTTGAATATGGGCTGGTGTCT
TATCAAATTCAAAGCACATCAAAAAAAGAGCAAAAAGAGATCAATGTAAAATCTGTCACGAATTCAGGCTCGGAAATGAC
CGCCCGGTTCATATTTGATTTGAAACAAAAAAAAGTTATTCATTGGGAAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

62.097

100

0.621


Multiple sequence alignment