Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BATR1942_RS10055 Genome accession   NC_014639
Coordinates   2073255..2073428 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus 1942     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2068255..2078428
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BATR1942_RS10040 (BATR1942_10600) gcvT 2069024..2070118 (-) 1095 WP_003325445.1 glycine cleavage system aminomethyltransferase GcvT -
  BATR1942_RS10045 (BATR1942_10605) - 2070579..2072249 (+) 1671 WP_003325444.1 DEAD/DEAH box helicase -
  BATR1942_RS10050 (BATR1942_10610) - 2072270..2073064 (+) 795 WP_003325443.1 YqhG family protein -
  BATR1942_RS10055 (BATR1942_10615) sinI 2073255..2073428 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  BATR1942_RS10060 (BATR1942_10620) sinR 2073462..2073797 (+) 336 WP_003325441.1 transcriptional regulator SinR Regulator
  BATR1942_RS10065 (BATR1942_10625) tasA 2073989..2074771 (-) 783 WP_003325439.1 biofilm matrix protein TasA -
  BATR1942_RS10070 (BATR1942_10630) sipW 2074835..2075407 (-) 573 WP_010789195.1 signal peptidase I SipW -
  BATR1942_RS10075 (BATR1942_10635) tapA 2075391..2076092 (-) 702 WP_003325437.1 amyloid fiber anchoring/assembly protein TapA -
  BATR1942_RS10080 (BATR1942_10640) - 2076354..2076677 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  BATR1942_RS10085 (BATR1942_10645) - 2076724..2076903 (-) 180 WP_003325435.1 YqzE family protein -
  BATR1942_RS10090 (BATR1942_10650) comGG 2076973..2077347 (-) 375 WP_003325434.1 competence type IV pilus minor pilin ComGG Machinery gene
  BATR1942_RS10095 (BATR1942_10655) comGF 2077348..2077743 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  BATR1942_RS10100 (BATR1942_10660) comGE 2077757..2078104 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=38771 BATR1942_RS10055 WP_003325442.1 2073255..2073428(+) (sinI) [Bacillus atrophaeus 1942]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=38771 BATR1942_RS10055 WP_003325442.1 2073255..2073428(+) (sinI) [Bacillus atrophaeus 1942]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789

Multiple sequence alignment