Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   FLP15_RS01215 Genome accession   NZ_CP041356
Coordinates   251284..251580 (-) Length   98 a.a.
NCBI ID   WP_142765689.1    Uniprot ID   A0A514Z638
Organism   Lactococcus protaetiae strain KACC 19320     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 246284..256580
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FLP15_RS01195 (FLP15_01195) - 246944..247753 (-) 810 WP_142765686.1 metal ABC transporter permease -
  FLP15_RS01200 (FLP15_01200) - 247746..248476 (-) 731 Protein_235 metal ABC transporter ATP-binding protein -
  FLP15_RS01205 (FLP15_01205) - 249047..249889 (-) 843 WP_142765687.1 zinc ABC transporter substrate-binding protein -
  FLP15_RS01210 (FLP15_01210) - 250259..250717 (-) 459 WP_142765688.1 zinc-dependent MarR family transcriptional regulator -
  FLP15_RS01215 (FLP15_01215) comGG 251284..251580 (-) 297 WP_142765689.1 competence type IV pilus minor pilin ComGG Machinery gene
  FLP15_RS01220 (FLP15_01220) comGF 251609..252001 (-) 393 WP_142767397.1 competence type IV pilus minor pilin ComGF Machinery gene
  FLP15_RS01225 (FLP15_01225) comGE 252012..252308 (-) 297 WP_142765690.1 competence type IV pilus minor pilin ComGE Machinery gene
  FLP15_RS01230 (FLP15_01230) comGD 252280..252711 (-) 432 WP_142765691.1 competence type IV pilus minor pilin ComGD Machinery gene
  FLP15_RS01235 (FLP15_01235) comGC 252671..252973 (-) 303 WP_120772581.1 competence type IV pilus major pilin ComGC Machinery gene
  FLP15_RS01240 (FLP15_01240) comGB 252977..253999 (-) 1023 WP_142767398.1 competence type IV pilus assembly protein ComGB Machinery gene
  FLP15_RS01245 (FLP15_01245) comGA 253905..254888 (-) 984 WP_142765692.1 competence type IV pilus ATPase ComGA Machinery gene
  FLP15_RS13680 - 255681..255905 (-) 225 Protein_245 helix-turn-helix transcriptional regulator -

Sequence


Protein


Download         Length: 98 a.a.        Molecular weight: 11122.58 Da        Isoelectric Point: 4.4131

>NTDB_id=371477 FLP15_RS01215 WP_142765689.1 251284..251580(-) (comGG) [Lactococcus protaetiae strain KACC 19320]
MVLALIFSLFLQFYLQEQVETQKHLLTEKDRLTAELMVSLAKQEKLGQSGEIQFSQGFLTYQRLTGSSVSTNNAVSTDSE
IQDSFEIHLSDGKVFQME

Nucleotide


Download         Length: 297 bp        

>NTDB_id=371477 FLP15_RS01215 WP_142765689.1 251284..251580(-) (comGG) [Lactococcus protaetiae strain KACC 19320]
ATGGTTCTAGCTTTGATTTTTAGTTTATTTTTACAGTTTTATTTACAAGAGCAAGTAGAAACACAGAAACATTTACTGAC
AGAAAAAGATAGACTGACAGCGGAGCTGATGGTATCTTTAGCAAAGCAAGAAAAATTAGGACAATCAGGAGAAATACAAT
TTAGCCAAGGTTTTTTGACTTATCAACGACTGACAGGTTCATCAGTAAGTACGAATAATGCTGTCAGTACTGACAGTGAA
ATTCAAGACAGTTTTGAGATTCATTTATCCGATGGGAAAGTTTTTCAAATGGAATAG

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

52.041

100

0.52


Multiple sequence alignment