Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | ES276_RS10760 | Genome accession | NZ_CP038252 |
| Coordinates | 2136568..2136693 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain TVO_1901936 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2131568..2141693
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES276_RS10730 (ES276_11405) | - | 2132442..2132984 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| ES276_RS10745 (ES276_11420) | - | 2133531..2134484 (+) | 954 | WP_001155321.1 | IS30-like element ISSpn8 family transposase | - |
| ES276_RS10750 (ES276_11425) | comE | 2134487..2135224 (-) | 738 | WP_000866067.1 | competence system response regulator transcription factor ComE | Regulator |
| ES276_RS10755 (ES276_11430) | comD | 2135221..2136547 (-) | 1327 | Protein_2108 | competence system sensor histidine kinase ComD | - |
| ES276_RS10760 (ES276_11435) | comC/comC2 | 2136568..2136693 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| ES276_RS10770 (ES276_11445) | rlmH | 2136975..2137454 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ES276_RS10775 (ES276_11450) | htrA | 2137637..2138818 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| ES276_RS10780 (ES276_11455) | spo0J | 2138876..2139634 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=352667 ES276_RS10760 WP_000799686.1 2136568..2136693(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_1901936]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=352667 ES276_RS10760 WP_000799686.1 2136568..2136693(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_1901936]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |