Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | ESP48_RS10200 | Genome accession | NZ_CP035306 |
| Coordinates | 1219659..1219868 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain IDCC2201 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1214659..1224868
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ESP48_RS06570 (ESP48_06570) | - | 1215097..1215606 (+) | 510 | WP_064355639.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ESP48_RS06575 (ESP48_06575) | - | 1215918..1216475 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| ESP48_RS06580 (ESP48_06580) | - | 1216478..1217128 (+) | 651 | WP_011226853.1 | phosphatase PAP2 family protein | - |
| ESP48_RS06585 (ESP48_06585) | comR | 1217323..1218222 (+) | 900 | WP_064355637.1 | helix-turn-helix domain-containing protein | Regulator |
| ESP48_RS09855 | - | 1218460..1219041 (+) | 582 | Protein_1210 | cysteine peptidase family C39 domain-containing protein | - |
| ESP48_RS09860 | comA | 1219026..1219316 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| ESP48_RS10200 (ESP48_06600) | comA | 1219659..1219868 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ESP48_RS06610 (ESP48_06610) | - | 1219923..1220491 (+) | 569 | Protein_1213 | ATP-binding cassette domain-containing protein | - |
| ESP48_RS06615 (ESP48_06615) | - | 1220599..1220916 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| ESP48_RS10205 | - | 1220879..1221163 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| ESP48_RS10210 | - | 1221403..1222299 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| ESP48_RS06625 (ESP48_06625) | - | 1222704..1223219 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ESP48_RS06630 (ESP48_06630) | - | 1223244..1223546 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ESP48_RS06635 (ESP48_06635) | - | 1223558..1223869 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=339207 ESP48_RS10200 WP_002946147.1 1219659..1219868(+) (comA) [Streptococcus thermophilus strain IDCC2201]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=339207 ESP48_RS10200 WP_002946147.1 1219659..1219868(+) (comA) [Streptococcus thermophilus strain IDCC2201]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |